Gene Information

Name : Tint_1277 (Tint_1277)
Accession : YP_003642995.1
Strain : Thiomonas intermedia K12
Genome accession: NC_014153
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1367313 - 1368041 bp
Length : 729 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bpy:Bphyt_5224 two component heavy metal response transcriptional regulator, winged helix family; SMART: response regulator receive

DNA sequence :
ATGTTGCAGACCGATACGTCGCTCTGCCAGCGGCGGGCCGACAATGCGGGGATGCGAATTCTCATTGTCGAAGATGAGGC
CAAAACGGCGGCCTATCTCAAGCGCGGACTCGGGGAGAACGGCTTCATCGCAGATGTCGCCGTCGATGGCACGGATGGTC
TGCATCTGGCGCTGACCCAGCCGTACGACTTGATCGTGCTCGATGCCATGCTGCCCGGCCGCGACGGCTGGAGCGTGCTG
AGCGAACTGCGGGCGCGGCAGACCACCCCGGTGCTCATGCTCACCGCGCGCGACGGCGTGGCCGATCGGGTGCGCGGACT
GGAGCTGGGCGCTGACGACTATCTGGTCAAGCCTTTCGCGTTTTCTGAGCTGCTGGCGCGGGTGCGCAGCGTGCTGCGGC
GCGGTGTCACGCGCATGCCCGACGTGATGGAAGTGGCCGATCTGCGGGTTGACATGCATCGCCAGCGCGCCGAGCGCAGC
GGGCAGCGGCTGGCGCTCACCCCCAAGGAGTTCGCGCTGCTGGCGCTGTTGTCACGACGCGCTGGCGAGGTGCTGTCGCG
CACCCTGATTGCCGAACAGGTCTGGGATATGAACTTCGACAGCGACACCAATGTGGTGGACGTACACATTCGTCGCTTAC
GCAGCAAGCTCGACGAGCCCTTCCCCGCGCCGCTGTTGCACACCGTCCGCGGGGTGGGTTATGTATTGGAAGTGCGCGAT
GCAAAGTGA

Protein sequence :
MLQTDTSLCQRRADNAGMRILIVEDEAKTAAYLKRGLGENGFIADVAVDGTDGLHLALTQPYDLIVLDAMLPGRDGWSVL
SELRARQTTPVLMLTARDGVADRVRGLELGADDYLVKPFAFSELLARVRSVLRRGVTRMPDVMEVADLRVDMHRQRAERS
GQRLALTPKEFALLALLSRRAGEVLSRTLIAEQVWDMNFDSDTNVVDVHIRRLRSKLDEPFPAPLLHTVRGVGYVLEVRD
AK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-58 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-57 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator BAC0197 Protein 8e-70 66
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator BAC0083 Protein 5e-66 62
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator BAC0125 Protein 9e-66 61
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-61 59
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-57 59
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator BAC0111 Protein 4e-64 58
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator BAC0347 Protein 7e-58 54
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-37 44
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-41 43
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-41 43
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-41 43
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-41 43
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-41 43
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-41 43
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-41 43
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-41 43
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 7e-29 43
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 8e-25 43
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 8e-27 42
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator BAC0533 Protein 8e-27 42
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 4e-25 42
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-32 42
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 5e-31 41
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-36 41
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 5e-31 41
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 4e-26 41
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 3e-26 41
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 3e-31 41
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 4e-26 41
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-36 41
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-36 41
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-36 41
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-36 41
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-36 41
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-36 41
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-36 41
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-36 41
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-36 41
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 8e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-58 56
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-36 50
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-36 43
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator VFG0473 Protein 1e-31 41
Tint_1277 YP_003642995.1 winged helix family two component transcriptional regulator VFG1386 Protein 6e-34 41