Gene Information

Name : TherJR_2641 (TherJR_2641)
Accession : YP_003641378.1
Strain : Thermincola potens JR
Genome accession: NC_014152
Putative virulence/resistance : Resistance
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2746982 - 2747656 bp
Length : 675 bp
Strand : -
Note : KEGG: dae:Dtox_2915 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGGGTGCCGGAAAAATATTGATTGCCGATGATGAAGCCCGGATGAGAAAATTGGTGGCAGATTTTCTGAAAAAAGAAGG
CTATGCAATAATTGAGGCTGCCGATGGGCGTCAGGCTCTTGACCTGTTTTATGGTAATAACGATATAGATTTAATTATCC
TGGATGTGATGATGCCTGGTTACGACGGATGGACGGTATGCAGGGAAATCAGAAAATCATCTCAGGTTCCTATTATCATG
CTCACTGCCAGGGGAGAGGAATCCGACGAGCTGTTCGGTTTTGACCTGGGCGCTGACGAATACATTGCCAAACCCTTCAG
TCTCAAGATACTGGCCGCCAGGATACAGGCTCTGTTAAGGCGCGTTCAGAATAACCGAACAGTCAGGTCCTTTGACGGGT
TGGAAATTGATGAGCAGGGCAGGTATGTTTATGTGGACGGCGAACCGGTAGACCTGAGCCCCAAGGAATTTGAACTGCTG
TTGTACCTGACGGAAAACGCGGGCAGAGCATTGAGCAGGGAGCAGATTTTAAATGCCGTCTGGGATTACGATTATTTCGG
TGATGTAAGAACGGTGGATACGCACATCAAGAAACTCCGGCTGAAGTTAGGTGAAAAAAGTTATCTCATCCAGACTGTCC
GGGGGCTGGGATATAGATTTGAGGTGAGGAAGTGA

Protein sequence :
MGAGKILIADDEARMRKLVADFLKKEGYAIIEAADGRQALDLFYGNNDIDLIILDVMMPGYDGWTVCREIRKSSQVPIIM
LTARGEESDELFGFDLGADEYIAKPFSLKILAARIQALLRRVQNNRTVRSFDGLEIDEQGRYVYVDGEPVDLSPKEFELL
LYLTENAGRALSREQILNAVWDYDYFGDVRTVDTHIKKLRLKLGEKSYLIQTVRGLGYRFEVRK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 7e-38 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 5e-42 46
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 4e-42 46
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 6e-42 46
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 6e-42 46
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 6e-42 46
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 6e-42 46
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 6e-42 46
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 6e-42 46
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 6e-42 46
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 1e-41 46
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family HE999704.1.gene1202. Protein 2e-39 43
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 2e-36 43
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 2e-40 43
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 4e-28 43
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family AF310956.2.orf0.gene Protein 3e-38 42
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 1e-37 42
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family BAC0596 Protein 4e-33 42
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 4e-33 42
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 3e-34 42
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family BAC0039 Protein 2e-34 42
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 2e-34 42
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 1e-34 42
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family CP001918.1.gene5135. Protein 2e-19 42
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family U35369.1.gene1.p01 Protein 4e-37 41
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family AE016830.1.gene2255. Protein 4e-37 41
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 8e-29 41
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 1e-38 41
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 5e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TherJR_2641 YP_003641378.1 two component transcriptional regulator, winged helix family VFG1386 Protein 2e-33 43