Gene Information

Name : TherJR_2129 (TherJR_2129)
Accession : YP_003640875.1
Strain : Thermincola potens JR
Genome accession: NC_014152
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2203622 - 2204332 bp
Length : 711 bp
Strand : -
Note : KEGG: chy:CHY_2047 DNA-binding response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
GTGTCCAAGCCCAAGATTCTGGTAGTAGACGATGAACAATATATCGTAGAATTAATCAGGTTTAACCTGGAAAAGGAAGG
GTATACAGTTATAACGGCTGGTGATGGAAAGATAGCTTTGGAACAAACATTTCGGGAAAAACCCGACCTGATTGTGCTTG
ATATCATGCTGCCAGGCGTGGACGGATTGGAAGTATGCCGTACTTTGCAGCGTGATAAGGAAACACAGTTGATACCTATA
ATAATGCTTACAGCAAAGGGAGAAGAAATTGACAAGGTTTTAGGGTTGGAACTGGGCGCAGATGATTATATGACTAAACC
CTTTAGTCCAAGGGAACTGGTAGCAAGGATTAAGGCGCGGCTCAGAAGAAACTTTAAAGCCCAGCAAAGTGATAACCAAG
AAAAAGAGAATATTTTAGCCATCGGCGGTCTTAAGATAGATATAGAAAAATTCAGTGTGTATCTAAATGGCCAAAAGGTT
GATTTTACACCGAAAGAATTTGAATTGTTAAAGCTGCTGGCCTCCAATCCGGGTAAAGTATTTACCCGTGAATATTTACT
GGAAAAAATTTGGGGTTATGATTTTGCCGGTGATACCAGAACCGTTGATGTGCATATCAGACACATCCGGAAAAAGATTG
AACCGGAGCAGGGGGAAAAGTTTGTCGAAACCGTCCGGGGTGTAGGTTATAAATTTAGGGAGATGGCGTAA

Protein sequence :
MSKPKILVVDDEQYIVELIRFNLEKEGYTVITAGDGKIALEQTFREKPDLIVLDIMLPGVDGLEVCRTLQRDKETQLIPI
IMLTAKGEEIDKVLGLELGADDYMTKPFSPRELVARIKARLRRNFKAQQSDNQEKENILAIGGLKIDIEKFSVYLNGQKV
DFTPKEFELLKLLASNPGKVFTREYLLEKIWGYDFAGDTRTVDVHIRHIRKKIEPEQGEKFVETVRGVGYKFREMA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-36 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-41 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-41 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-35 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 3e-59 57
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 6e-56 53
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 6e-56 53
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 7e-56 53
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 6e-56 53
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 6e-56 53
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 6e-56 53
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 6e-56 53
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 6e-56 53
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 6e-56 53
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 6e-56 53
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 6e-49 52
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 1e-49 50
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 3e-54 50
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 2e-46 49
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 1e-39 46
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 4e-46 45
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 1e-37 45
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 6e-45 45
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 6e-45 45
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 1e-43 45
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 7e-40 44
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 6e-39 44
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 3e-39 44
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 2e-39 44
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family BAC0596 Protein 6e-39 44
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family BAC0039 Protein 3e-39 44
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 5e-42 43
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 5e-42 43
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 5e-42 43
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 5e-42 43
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 5e-42 43
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 5e-42 43
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 5e-42 43
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 5e-42 43
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 2e-37 43
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 8e-38 43
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family AF130997.1.orf0.gene Protein 5e-34 42
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family CP000034.1.gene3834. Protein 6e-33 42
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family CP001138.1.gene4273. Protein 8e-33 42
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family NC_002695.1.915041.p Protein 6e-33 42
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 2e-33 42
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family BAC0533 Protein 2e-32 41
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 3e-33 41
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family CP000647.1.gene4257. Protein 2e-32 41
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family CP004022.1.gene3215. Protein 2e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family VFG1389 Protein 1e-35 44
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family VFG0596 Protein 3e-36 43
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family VFG1563 Protein 2e-41 43
TherJR_2129 YP_003640875.1 two component transcriptional regulator, winged helix family VFG1702 Protein 6e-42 43