
|
Name : emrE (THI_0030) Accession : YP_003622665.1 Strain : Thiomonas sp. 3As Genome accession: NC_014145 Putative virulence/resistance : Resistance Product : Multidrug transporter emrE (Efflux-multidrug resistance protein emrE) (Methyl viologen resistance protein C) (Ethidium resistance protein) Function : - COG functional category : - COG ID : - EC number : - Position : 34219 - 34551 bp Length : 333 bp Strand : + Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 10383465, 14633977, 14755055, 15044024, 15111102, 15175281, 92319648; Product type t : transporter DNA sequence : ATGCAATCCTGGTTATTTCTGTTCGGCGCGATAGCGGCCGAGGTGATCGGCACCACCGCGCTCAAGGCCACGCACGGCTT CACGCGTCTGGCCCCTTCAGTGGTGGTCGTGGCGGCTTACGCCCTGGCGTTTTACCTGCTGTCACGCACCATGCAGACCA TTCCGATGAGCATTTCCTATGCCGTCTGGTCGGGCGTGGGCATCGTGCTCATCACCCTGATCGGCTATGTGGTTTATCAC CAGTCGCTCGACTTGCCCGCGCTCGTCGGGCTGGGGCTGATTCTCGCCGGTGTGCTGGTCATCCACCTGTTCTCCAAATC GGTGGCGCATTAA Protein sequence : MQSWLFLFGAIAAEVIGTTALKATHGFTRLAPSVVVVAAYALAFYLLSRTMQTIPMSISYAVWSGVGIVLITLIGYVVYH QSLDLPALVGLGLILAGVLVIHLFSKSVAH |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| qacEdelta1 | CAJ77088.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 3e-08 | 53 |
| qacEdelta1 | AFV53123.1 | QacEdelta1 multidrug exporter | Not tested | AbGRI2-1 | Protein | 3e-08 | 53 |
| qacEdelta1 | AGF35063.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-08 | 53 |
| qacE-deltal | ACF06159.1 | quartenary ammonium compound resistance protein | Not tested | Tn5036-like | Protein | 3e-08 | 53 |
| qacEdelta1 | AAK02047.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 3e-08 | 53 |
| qacEdelta1 | AGK36647.1 | QacEdelta1 | Not tested | AbaR26 | Protein | 3e-08 | 53 |
| qacEdelta1 | AGK06933.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-08 | 53 |
| qacE-delta1 | ACY75523.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 3e-08 | 53 |
| qacEdelta1 | AAK02056.1 | quaternary ammonium compound and disinfectant protein | Not tested | SGI1 | Protein | 3e-08 | 53 |
| qacEdelta1 | AGK06970.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-08 | 53 |
| qacE-delta1 | ACY75532.1 | QacE-delta1 | Not tested | Tn6060 | Protein | 3e-08 | 53 |
| qacEdelta1 | ABB48428.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-08 | 53 |
| ACICU_00227 | YP_001844886.1 | membrane transporter | Not tested | AbaR20 | Protein | 4e-08 | 53 |
| qacEdelta1 | AGK06979.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-08 | 53 |
| qacEdelta1 | ABZ01839.1 | QacEdelta1 | Not tested | SGI2 | Protein | 3e-08 | 53 |
| qacEdelta1 | YP_005797134.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 4e-08 | 53 |
| qacEdelta1 | AGK07016.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-08 | 53 |
| qacE-delta1 | AET25389.1 | QacE-delta1 | Not tested | PAGI-2(C) | Protein | 3e-08 | 53 |
| qacEdelta1 | CAJ77030.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 3e-08 | 53 |
| qacEdelta1 | YP_005797150.1 | quaternary ammonium compound-resistance protein | Not tested | AbaR4e | Protein | 4e-08 | 53 |
| qacEdelta1 | AGK07074.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-08 | 53 |
| qacE-delta1 | AFG30112.1 | QacE-delta1 | Not tested | PAGI-2 | Protein | 3e-08 | 53 |
| qacEdelta1 | CAJ77049.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 3e-08 | 53 |
| ebr | YP_006098377.1 | putative ethidium bromide resistance protein | Not tested | Tn2411 | Protein | 4e-08 | 53 |
| qacEdelta1 | AGK07100.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-08 | 53 |
| qacEdelta1 | AGF34989.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-08 | 53 |
| qacEdelta1 | CAJ77052.1 | Quaternary ammonium compound-resistance protein | Not tested | AbaR1 | Protein | 3e-08 | 53 |
| qacEdelta1 | ACN81026.1 | QacEdelta1 | Not tested | AbaR5 | Protein | 4e-08 | 53 |
| qacEdelta1 | AGK07109.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-08 | 53 |
| qacEdelta1 | AGF35028.1 | QacEdelta1 | Not tested | SGI1 | Protein | 3e-08 | 53 |
| unnamed | CAD42067.1 | hypothetical protein | Not tested | PAI II 536 | Protein | 1e-05 | 45 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| emrE | YP_003622665.1 | Multidrug transporter emrE (Efflux-multidrug resistance protein emrE) (Methyl viologen resistance protein C) (Ethidium resistance protein) | BAC0002 | Protein | 6e-08 | 59 |
| emrE | YP_003622665.1 | Multidrug transporter emrE (Efflux-multidrug resistance protein emrE) (Methyl viologen resistance protein C) (Ethidium resistance protein) | NC_010410.6003348.p0 | Protein | 6e-08 | 59 |
| emrE | YP_003622665.1 | Multidrug transporter emrE (Efflux-multidrug resistance protein emrE) (Methyl viologen resistance protein C) (Ethidium resistance protein) | BAC0324 | Protein | 6e-09 | 58 |
| emrE | YP_003622665.1 | Multidrug transporter emrE (Efflux-multidrug resistance protein emrE) (Methyl viologen resistance protein C) (Ethidium resistance protein) | CP001138.1.gene1489. | Protein | 4e-08 | 57 |
| emrE | YP_003622665.1 | Multidrug transporter emrE (Efflux-multidrug resistance protein emrE) (Methyl viologen resistance protein C) (Ethidium resistance protein) | BAC0322 | Protein | 9e-09 | 53 |
| emrE | YP_003622665.1 | Multidrug transporter emrE (Efflux-multidrug resistance protein emrE) (Methyl viologen resistance protein C) (Ethidium resistance protein) | BAC0323 | Protein | 1e-08 | 53 |
| emrE | YP_003622665.1 | Multidrug transporter emrE (Efflux-multidrug resistance protein emrE) (Methyl viologen resistance protein C) (Ethidium resistance protein) | NC_002695.1.913273.p | Protein | 2e-06 | 52 |
| emrE | YP_003622665.1 | Multidrug transporter emrE (Efflux-multidrug resistance protein emrE) (Methyl viologen resistance protein C) (Ethidium resistance protein) | BAC0150 | Protein | 2e-06 | 52 |
| emrE | YP_003622665.1 | Multidrug transporter emrE (Efflux-multidrug resistance protein emrE) (Methyl viologen resistance protein C) (Ethidium resistance protein) | BAC0377 | Protein | 1e-06 | 52 |
| emrE | YP_003622665.1 | Multidrug transporter emrE (Efflux-multidrug resistance protein emrE) (Methyl viologen resistance protein C) (Ethidium resistance protein) | CP004022.1.gene1549. | Protein | 6e-07 | 48 |
| emrE | YP_003622665.1 | Multidrug transporter emrE (Efflux-multidrug resistance protein emrE) (Methyl viologen resistance protein C) (Ethidium resistance protein) | BAC0325 | Protein | 3e-07 | 43 |
| emrE | YP_003622665.1 | Multidrug transporter emrE (Efflux-multidrug resistance protein emrE) (Methyl viologen resistance protein C) (Ethidium resistance protein) | BAC0327 | Protein | 3e-06 | 43 |
| emrE | YP_003622665.1 | Multidrug transporter emrE (Efflux-multidrug resistance protein emrE) (Methyl viologen resistance protein C) (Ethidium resistance protein) | BAC0378 | Protein | 8e-05 | 42 |
| emrE | YP_003622665.1 | Multidrug transporter emrE (Efflux-multidrug resistance protein emrE) (Methyl viologen resistance protein C) (Ethidium resistance protein) | BAC0329 | Protein | 1e-08 | 42 |
| emrE | YP_003622665.1 | Multidrug transporter emrE (Efflux-multidrug resistance protein emrE) (Methyl viologen resistance protein C) (Ethidium resistance protein) | BAC0140 | Protein | 2e-05 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| emrE | YP_003622665.1 | Multidrug transporter emrE (Efflux-multidrug resistance protein emrE) (Methyl viologen resistance protein C) (Ethidium resistance protein) | VFG1586 | Protein | 5e-06 | 45 |