Gene Information

Name : merR1 (THI_1802)
Accession : YP_003624300.1
Strain : Thiomonas sp. 3As
Genome accession: NC_014145
Putative virulence/resistance : Resistance
Product : Mercuric resistance operon regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1789115 - 1789537 bp
Length : 423 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 2666393; Product type r : regulator

DNA sequence :
ATGATGCAACTCAATTCAAATGGTTTGACCATCGGCGCCGTCGCCAAGGCGGTCGGCGTCAACGTCGAAACCATTCGGTT
CTACCAGCGCAAGGGCTTGCTGGGTGAACCCGAGCGAACCCAGGGAAGCTTCCGTCATTACGGGCCAGGTGACGTTGCCC
GCCTGCGTTTCATCAAATCGGCCCAAGGTCTGGGCTTCAGCCTCGACGAGATTGCCGGTCTGCTACAGCTCGATGACGGC
ATGCACTGCGACCAGGCGCGTGAGCTCGGTGAGCGCAAGCTCCGCGATGTGCGCACCAAGCTCGATAACCTCAGGCGCAT
CGAGTCGGCGCTGGCCGAGATGATTCGCGCCTGCGCCTGCAGCGATGGCTCCATGTCCTGCCCCCTGATCGACGCGCTCC
ACGGCGAGGTTCACGCTCCCTGA

Protein sequence :
MMQLNSNGLTIGAVAKAVGVNVETIRFYQRKGLLGEPERTQGSFRHYGPGDVARLRFIKSAQGLGFSLDEIAGLLQLDDG
MHCDQARELGERKLRDVRTKLDNLRRIESALAEMIRACACSDGSMSCPLIDALHGEVHAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 2e-39 65
merR ACK44535.1 MerR Not tested SGI1 Protein 8e-38 61
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 8e-38 61
merR AFG30124.1 MerR Not tested PAGI-2 Protein 8e-38 61
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 1e-37 61
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 2e-38 61
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 3e-38 61
merR AGK07025.1 MerR Not tested SGI1 Protein 3e-37 60
merR AGK07083.1 MerR Not tested SGI1 Protein 3e-37 60
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 2e-35 58
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-26 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merR1 YP_003624300.1 Mercuric resistance operon regulatory protein BAC0686 Protein 5e-39 62
merR1 YP_003624300.1 Mercuric resistance operon regulatory protein BAC0688 Protein 2e-38 61
merR1 YP_003624300.1 Mercuric resistance operon regulatory protein BAC0684 Protein 6e-39 61
merR1 YP_003624300.1 Mercuric resistance operon regulatory protein BAC0687 Protein 1e-37 61
merR1 YP_003624300.1 Mercuric resistance operon regulatory protein BAC0232 Protein 1e-37 61
merR1 YP_003624300.1 Mercuric resistance operon regulatory protein BAC0683 Protein 2e-38 60
merR1 YP_003624300.1 Mercuric resistance operon regulatory protein BAC0689 Protein 5e-35 57
merR1 YP_003624300.1 Mercuric resistance operon regulatory protein BAC0682 Protein 2e-21 41