Gene Information

Name : czcR (THI_1599)
Accession : YP_003624112.1
Strain : Thiomonas sp. 3As
Genome accession: NC_014145
Putative virulence/resistance : Virulence
Product : Transcriptional activator protein czcR
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1583549 - 1584277 bp
Length : 729 bp
Strand : +
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 9044283; Product type r : regulator

DNA sequence :
ATGTTGCAGACCGATACGTCGCTCTGCCAGCGGCGAGCCGACAATGCAGGGATGCGAATTCTCATTGTCGAAGACGAGGC
CAAAACGGCGGCCTATCTCAAGCGCGGGCTCGGGGAGAATGGCTTCATCGCGGATGTCGCCGTCGATGGCACGGATGGTC
TGCATCTGGCGCTGACTCAGCCGTACGACTTGATCGTGCTCGATGCCATGCTGCCCGGCCGCGACGGCTGGAGTGTGTTG
AGCGAACTGCGGGCGCGGCAGACCACCCCGGTACTCATGCTCACCGCGCGCGACGGCGTGGCCGATCGGGTACGCGGGCT
GGAGCTGGGCGCCGACGACTATCTGGTCAAGCCTTTCGCGTTTTCCGAGCTGCTGGCGCGGGTGCGCAGCGTGCTGCGGC
GCGGTGTCACGCGCCTGCCGGAAGTGATGGAAGTGGCCGATCTGCGGGTTGACATGCATCGCCAGCGCGCCGAGCGCGGC
GGGCAGCGGCTGGCGCTCACCCCCAAGGAGTTCGCGCTGCTGGCGCTGTTGTCACGACGCGCTGGCGAGGTGCTGTCGCG
CACCCTGATTGCCGAACAGGTCTGGGATATGAACTTCGACAGCGACACCAATGTGGTGGACGTACACATTCGTCGCTTGC
GCAGCAAGCTCGACGAGCCCTTCCCCGCGCCGCTGTTGCACACCGTCCGCGGGGTGGGTTATGTATTGGAAGTGCGCGAT
GCAAAGTGA

Protein sequence :
MLQTDTSLCQRRADNAGMRILIVEDEAKTAAYLKRGLGENGFIADVAVDGTDGLHLALTQPYDLIVLDAMLPGRDGWSVL
SELRARQTTPVLMLTARDGVADRVRGLELGADDYLVKPFAFSELLARVRSVLRRGVTRLPEVMEVADLRVDMHRQRAERG
GQRLALTPKEFALLALLSRRAGEVLSRTLIAEQVWDMNFDSDTNVVDVHIRRLRSKLDEPFPAPLLHTVRGVGYVLEVRD
AK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-58 56
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-57 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_003624112.1 Transcriptional activator protein czcR BAC0197 Protein 2e-69 66
czcR YP_003624112.1 Transcriptional activator protein czcR BAC0083 Protein 3e-66 62
czcR YP_003624112.1 Transcriptional activator protein czcR BAC0125 Protein 6e-66 62
czcR YP_003624112.1 Transcriptional activator protein czcR BAC0638 Protein 3e-57 59
czcR YP_003624112.1 Transcriptional activator protein czcR BAC0111 Protein 6e-64 58
czcR YP_003624112.1 Transcriptional activator protein czcR BAC0308 Protein 3e-61 58
czcR YP_003624112.1 Transcriptional activator protein czcR BAC0347 Protein 9e-58 54
czcR YP_003624112.1 Transcriptional activator protein czcR NC_010079.5776364.p0 Protein 4e-41 43
czcR YP_003624112.1 Transcriptional activator protein czcR NC_002952.2859858.p0 Protein 4e-41 43
czcR YP_003624112.1 Transcriptional activator protein czcR NC_007622.3794948.p0 Protein 4e-41 43
czcR YP_003624112.1 Transcriptional activator protein czcR NC_003923.1003417.p0 Protein 4e-41 43
czcR YP_003624112.1 Transcriptional activator protein czcR NC_013450.8614146.p0 Protein 4e-41 43
czcR YP_003624112.1 Transcriptional activator protein czcR NC_002951.3238224.p0 Protein 4e-41 43
czcR YP_003624112.1 Transcriptional activator protein czcR NC_007793.3914065.p0 Protein 4e-41 43
czcR YP_003624112.1 Transcriptional activator protein czcR NC_002758.1121390.p0 Protein 4e-41 43
czcR YP_003624112.1 Transcriptional activator protein czcR AE015929.1.gene1106. Protein 2e-37 43
czcR YP_003624112.1 Transcriptional activator protein czcR AE000516.2.gene3505. Protein 2e-32 43
czcR YP_003624112.1 Transcriptional activator protein czcR U82965.2.orf14.gene. Protein 2e-28 43
czcR YP_003624112.1 Transcriptional activator protein czcR CP001918.1.gene5135. Protein 1e-24 43
czcR YP_003624112.1 Transcriptional activator protein czcR NC_003923.1003749.p0 Protein 3e-36 42
czcR YP_003624112.1 Transcriptional activator protein czcR BAC0533 Protein 1e-26 42
czcR YP_003624112.1 Transcriptional activator protein czcR CP000647.1.gene4257. Protein 1e-26 42
czcR YP_003624112.1 Transcriptional activator protein czcR Y16952.3.orf35.gene. Protein 8e-25 42
czcR YP_003624112.1 Transcriptional activator protein czcR CP000675.2.gene1535. Protein 7e-35 41
czcR YP_003624112.1 Transcriptional activator protein czcR HE999704.1.gene1528. Protein 2e-30 41
czcR YP_003624112.1 Transcriptional activator protein czcR NC_002952.2859905.p0 Protein 4e-36 41
czcR YP_003624112.1 Transcriptional activator protein czcR CP004022.1.gene3215. Protein 5e-31 41
czcR YP_003624112.1 Transcriptional activator protein czcR CP000034.1.gene3834. Protein 6e-26 41
czcR YP_003624112.1 Transcriptional activator protein czcR CP001138.1.gene4273. Protein 3e-26 41
czcR YP_003624112.1 Transcriptional activator protein czcR NC_002695.1.915041.p Protein 6e-26 41
czcR YP_003624112.1 Transcriptional activator protein czcR NC_009641.5332272.p0 Protein 4e-36 41
czcR YP_003624112.1 Transcriptional activator protein czcR NC_013450.8614421.p0 Protein 4e-36 41
czcR YP_003624112.1 Transcriptional activator protein czcR NC_007793.3914279.p0 Protein 4e-36 41
czcR YP_003624112.1 Transcriptional activator protein czcR NC_007622.3794472.p0 Protein 4e-36 41
czcR YP_003624112.1 Transcriptional activator protein czcR NC_002745.1124361.p0 Protein 4e-36 41
czcR YP_003624112.1 Transcriptional activator protein czcR NC_009782.5559369.p0 Protein 4e-36 41
czcR YP_003624112.1 Transcriptional activator protein czcR NC_002951.3237708.p0 Protein 4e-36 41
czcR YP_003624112.1 Transcriptional activator protein czcR NC_002758.1121668.p0 Protein 4e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
czcR YP_003624112.1 Transcriptional activator protein czcR VFG0596 Protein 9e-59 56
czcR YP_003624112.1 Transcriptional activator protein czcR VFG1389 Protein 5e-36 50
czcR YP_003624112.1 Transcriptional activator protein czcR VFG1390 Protein 8e-37 44
czcR YP_003624112.1 Transcriptional activator protein czcR VFG0473 Protein 2e-31 41
czcR YP_003624112.1 Transcriptional activator protein czcR VFG1386 Protein 9e-34 41