Gene Information

Name : merR (THI_p0008)
Accession : YP_003622577.1
Strain :
Genome accession: NC_014144
Putative virulence/resistance : Resistance
Product : Mercuric resistance operon regulatory protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4718 - 5116 bp
Length : 399 bp
Strand : -
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 2666393; Product type r : regulator

DNA sequence :
ATGGGCGCAGACCTGACCATCGGCAAGCTGGCGGACGCTGCCGGAGTGAACATCGAGACGATCCGCTATTACCAGCGGCG
CGGGCTGCTGGATGAACCGGCCAAGCCGCTGGGCGGCCATCGGCGCTATCCGGCAGGGGAGGCCAAGCGGGTGCGCTTCA
TCAAGCGGGCGCAGGCGCTGGGCTTCACGCTGGATGAAGTCGGCATGCTGCTGACGCTGGACTCGGCGTGTGGCTGCTCG
GACACGCGGGCGCTGGCCGCCCGAAAGCAGGGACTGATCGAGCGAAAGATGGCCGACCTGACGGCCATGTACCAAGCGCT
GGGCGATCTGATCCAGCAATGCGATACCGGTGGCAGCACAAGGCCGTGCCCGATCATCGACGTGCTGGAGCGTGACTGA

Protein sequence :
MGADLTIGKLADAAGVNIETIRYYQRRGLLDEPAKPLGGHRRYPAGEAKRVRFIKRAQALGFTLDEVGMLLTLDSACGCS
DTRALAARKQGLIERKMADLTAMYQALGDLIQQCDTGGSTRPCPIIDVLERD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 1e-35 61
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 1e-27 50
merR AGK07025.1 MerR Not tested SGI1 Protein 9e-27 48
merR AGK07083.1 MerR Not tested SGI1 Protein 9e-27 48
merR ACK44535.1 MerR Not tested SGI1 Protein 6e-27 48
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 6e-27 48
merR AFG30124.1 MerR Not tested PAGI-2 Protein 6e-27 48
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 9e-27 48
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 1e-27 48
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 2e-27 48
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 9e-27 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merR YP_003622577.1 Mercuric resistance operon regulatory protein BAC0684 Protein 2e-28 50
merR YP_003622577.1 Mercuric resistance operon regulatory protein BAC0688 Protein 3e-28 50
merR YP_003622577.1 Mercuric resistance operon regulatory protein BAC0683 Protein 1e-27 49
merR YP_003622577.1 Mercuric resistance operon regulatory protein BAC0689 Protein 1e-26 49
merR YP_003622577.1 Mercuric resistance operon regulatory protein BAC0232 Protein 3e-27 48
merR YP_003622577.1 Mercuric resistance operon regulatory protein BAC0686 Protein 2e-28 48
merR YP_003622577.1 Mercuric resistance operon regulatory protein BAC0687 Protein 3e-27 48
merR YP_003622577.1 Mercuric resistance operon regulatory protein BAC0682 Protein 4e-19 42