Name : merP (THI_p0010) Accession : YP_003622579.1 Strain : Genome accession: NC_014144 Putative virulence/resistance : Resistance Product : Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) Function : - COG functional category : - COG ID : - EC number : - Position : 5552 - 5827 bp Length : 276 bp Strand : + Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 6091128, 9188683, 9649312; Product type t : transporter DNA sequence : ATGCGCAAATTACTCATCGCTCTACTGGTTGCCTTGCCGTTCACGGTGCTGGCCGCGCCGTCGAAAACGGTCACACTGGC CGTCCAGAACATGACCTGTCCGCTGTGCCCGATCACGGTCAAGAAATCGCTGGAGAAGGTAGCTGGCGTCAGCGCAGTAC AGGTCGATTTCGACAAAAAAACAGCCACCGTCACCTACGACCCGGACAAGGCCCAGCCGGAAGCGCTGACCAAGGCCACG ACCAACGCGGGCTACCCGTCCGCCGTGCAGAAGTGA Protein sequence : MRKLLIALLVALPFTVLAAPSKTVTLAVQNMTCPLCPITVKKSLEKVAGVSAVQVDFDKKTATVTYDPDKAQPEALTKAT TNAGYPSAVQK |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
merP | AAN62179.1 | periplasmic mercuric ion binding protein MerP | Not tested | PAGI-2(C) | Protein | 4e-17 | 60 |
merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 3e-15 | 55 |
merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 4e-15 | 55 |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 8e-17 | 54 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 8e-17 | 54 |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 8e-17 | 54 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 8e-17 | 54 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 8e-17 | 54 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 1e-16 | 54 |
unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 3e-16 | 54 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
merP | YP_003622579.1 | Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) | BAC0679 | Protein | 8e-16 | 56 |
merP | YP_003622579.1 | Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) | BAC0675 | Protein | 3e-16 | 52 |
merP | YP_003622579.1 | Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) | BAC0231 | Protein | 3e-17 | 51 |
merP | YP_003622579.1 | Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) | BAC0678 | Protein | 4e-16 | 50 |
merP | YP_003622579.1 | Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) | BAC0674 | Protein | 3e-13 | 50 |