Gene Information

Name : ompR (lpa_01105)
Accession : YP_003618003.1
Strain : Legionella pneumophila 2300/99 Alcoy
Genome accession: NC_014125
Putative virulence/resistance : Virulence
Product : two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 877266 - 877937 bp
Length : 672 bp
Strand : -
Note : COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]

DNA sequence :
ATGCGATTATTAATTGTTGAAGACCATAAAAGAACGGCTGATTTTATCTGTAAAGGATTTAATGAATATCAATTTCAGGC
AGATGCTGTATACGATGGTGCAGAAGCAATCTATCGAATCTCAGAAATTAACTACGATGCTGTTGTTTTAGACGTTATGT
TACCCATAATGGATGGATGGGCTGTACTTGAAAAGATTCGTGAACTAAAACCTGATTTACCTGTTTTAATGCTTTCTGCC
TGCGACGATGTCGATAGTCGTGTGAAAGGGCTTGAAATGGGTGCCTATGATTATCTTGTTAAACCTTTTTCCTTCAATGA
GCTCCTTGCCCGAGTAAAATCTTTACTACGAAGAAAACCCAAAGAGAGCCCTATCTTATTAAAGATTAATGATTTAACTC
TAAACTTACAAAAGCATACAGCAATACGAGGCGACAAAAAGTTACCTTTAACAGCAAAAGAATTCATGTTATTGACGTTT
ATGTTGAAACGAAGTGGTGAAGTGCTTTCAAGGACAGTCATTGCTGAACAAGTTTGGGATATTAATTTTGACACGAATAC
CAATATCATTGATGTAGCGATCAAGCGTTTAAGGGAAAAAGTGGATAATGATCATCCTACTAAATTGATCCATACCGTCA
GAGGAGTAGGCTATGTATTGGAGATTCGCTAA

Protein sequence :
MRLLIVEDHKRTADFICKGFNEYQFQADAVYDGAEAIYRISEINYDAVVLDVMLPIMDGWAVLEKIRELKPDLPVLMLSA
CDDVDSRVKGLEMGAYDYLVKPFSFNELLARVKSLLRRKPKESPILLKINDLTLNLQKHTAIRGDKKLPLTAKEFMLLTF
MLKRSGEVLSRTVIAEQVWDINFDTNTNIIDVAIKRLREKVDNDHPTKLIHTVRGVGYVLEIR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-45 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-45 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ompR YP_003618003.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0197 Protein 3e-55 53
ompR YP_003618003.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0125 Protein 3e-55 52
ompR YP_003618003.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0083 Protein 2e-54 51
ompR YP_003618003.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0308 Protein 3e-55 50
ompR YP_003618003.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0111 Protein 1e-53 49
ompR YP_003618003.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0638 Protein 3e-48 49
ompR YP_003618003.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0347 Protein 3e-48 48

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ompR YP_003618003.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR VFG0596 Protein 1e-45 47
ompR YP_003618003.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR VFG1390 Protein 2e-38 42
ompR YP_003618003.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR VFG1389 Protein 4e-33 42