Gene Information

Name : ECL_03153 (ECL_03153)
Accession : YP_003613638.1
Strain : Enterobacter cloacae ATCC 13047
Genome accession: NC_014121
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : K : Transcription
COG ID : COG4977
EC number : -
Position : 3217961 - 3218335 bp
Length : 375 bp
Strand : -
Note : -

DNA sequence :
ATGATCAATCAGGAAGCTGAAGGGGAGAGCAGTATGACCATTTCCGCTCAAGTCATCGACACTATCGTCGAGTGGATCGA
CGATAACCTGCACCAGCCATTACGTATCGAAGAGATTGCCCGCCATGCGGGTTACTCGAAATGGCACCTGCAGCGGCTGT
TTATGCAATACAAAGGGGAGAGTCTGGGGCGCTATATCCGTGAACGCAAGCTGCTGCTGGCGGCGCGGGATCTGCGCGAA
TCAGACGCCCGGGTATACGACATCTGCCTGCGTTACGGGTTTGACTCGCAGCAGACCTTCACTCGCATCTTCACCCGCAC
GTTCAACCAGCCGCCTGGGGCGTATCGTAAAGAGAACCACAGCAGGGCACACTGA

Protein sequence :
MINQEAEGESSMTISAQVIDTIVEWIDDNLHQPLRIEEIARHAGYSKWHLQRLFMQYKGESLGRYIRERKLLLAARDLRE
SDARVYDICLRYGFDSQQTFTRIFTRTFNQPPGAYRKENHSRAH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 1e-19 49
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 2e-16 43
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 2e-16 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECL_03153 YP_003613638.1 hypothetical protein CP001138.1.gene612.p Protein 5e-41 88
ECL_03153 YP_003613638.1 hypothetical protein CP001918.1.gene2033. Protein 2e-18 50
ECL_03153 YP_003613638.1 hypothetical protein CP000647.1.gene1624. Protein 3e-18 50
ECL_03153 YP_003613638.1 hypothetical protein CP001918.1.gene327.p Protein 2e-20 49
ECL_03153 YP_003613638.1 hypothetical protein CP000647.1.gene4499. Protein 5e-20 49
ECL_03153 YP_003613638.1 hypothetical protein CP001138.1.gene4488. Protein 3e-20 49
ECL_03153 YP_003613638.1 hypothetical protein CP001138.1.gene1637. Protein 2e-18 49
ECL_03153 YP_003613638.1 hypothetical protein NC_002695.1.917339.p Protein 1e-18 48
ECL_03153 YP_003613638.1 hypothetical protein BAC0560 Protein 1e-18 48
ECL_03153 YP_003613638.1 hypothetical protein CP000034.1.gene1596. Protein 8e-19 48
ECL_03153 YP_003613638.1 hypothetical protein NC_002695.1.914293.p Protein 3e-19 46
ECL_03153 YP_003613638.1 hypothetical protein BAC0371 Protein 3e-19 46
ECL_03153 YP_003613638.1 hypothetical protein CP000034.1.gene4505. Protein 6e-19 45
ECL_03153 YP_003613638.1 hypothetical protein NC_010558.1.6276025. Protein 1e-16 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECL_03153 YP_003613638.1 hypothetical protein VFG0585 Protein 3e-20 49
ECL_03153 YP_003613638.1 hypothetical protein VFG1038 Protein 1e-16 43