Gene Information

Name : ECL_02281 (ECL_02281)
Accession : YP_003612778.1
Strain : Enterobacter cloacae ATCC 13047
Genome accession: NC_014121
Putative virulence/resistance : Unknown
Product : putative IS911 transposase orfB
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 2338522 - 2338824 bp
Length : 303 bp
Strand : -
Note : -

DNA sequence :
ATGAAAAAAAGAAATTTCAGCGCAGAGTTTAAACGCGAATCCGCTCAACTGGTCGTTGACCAGAACTACACCGTGGCAGA
TGCAGCCAGCGCTATGGATGTCGGCCTTTCCACAATGACGCGATGGGTGAAACAATTACGTGATGAACGGCAGGGCAAAA
CACCAAAAGCCTCCCCCATTACCCCGGAACAAATTGAAATCCGTGAGCTCAGGAAAAAGCTACAACGTATTGAAATGGAA
AATGAAATATTAAAAAAGGCTACCGCGCTCTTGATGTCAGACTCCCTGAACAGTTCTCGATAA

Protein sequence :
MKKRNFSAEFKRESAQLVVDQNYTVADAASAMDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIRELRKKLQRIEME
NEILKKATALLMSDSLNSSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
l7045 CAD33744.1 - Not tested PAI I 536 Protein 9e-41 98
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 9e-41 98
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-35 97
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 9e-40 94
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 78
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 78
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 78
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-31 78
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 78
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-31 78
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-31 78
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-31 78
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 2e-29 72
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 1e-24 62
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 8e-25 62
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 3e-23 60
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 4e-23 60
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 4e-23 60
unnamed AAC31483.1 L0004 Not tested LEE Protein 3e-23 60
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-22 58
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 1e-20 48
tnpA CAB61575.1 transposase A Not tested HPI Protein 4e-20 47
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 2e-12 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECL_02281 YP_003612778.1 putative IS911 transposase orfB VFG1485 Protein 4e-41 98
ECL_02281 YP_003612778.1 putative IS911 transposase orfB VFG1123 Protein 8e-32 78
ECL_02281 YP_003612778.1 putative IS911 transposase orfB VFG1553 Protein 1e-29 72
ECL_02281 YP_003612778.1 putative IS911 transposase orfB VFG0784 Protein 1e-23 60
ECL_02281 YP_003612778.1 putative IS911 transposase orfB VFG1566 Protein 1e-12 42