Gene Information

Name : BC1002_6907 (BC1002_6907)
Accession : YP_003610217.1
Strain :
Genome accession: NC_014120
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 143926 - 144270 bp
Length : 345 bp
Strand : +
Note : PFAM: IS66 Orf2 family protein; KEGG: bxe:Bxe_A0258 hypothetical protein

DNA sequence : 
ATGATCTCCCTACCGGCGGGCACGCGCATCTGGATCGCTGCTGGTGTCACTGATATGCGATGCGGGTTTCATGGGTTGGC
AGCGAAGGTGCAAACAGCGCTTGAGGAGAATCAGCTGTGCGGCAACGTCTACATCTTCCGGGGCCGTCGGGGCGATCTGG
TAAAGATTCTCTGGGCTACGGAGGACGGAATCTGGCTGCTCGCGAAGCGGCTTGAACGAGGCCGTTTTAGATGGCCCAAG
GCCGACGGTGGCAAGGTCCATCTGAGCTCTGCGCAACTGTTGATGCTGCTTGAGGGCATCGACTGGCGACAGCCCCGTCG
CACTGCCGCACTATCGATGTTGTAA

Protein sequence : 
MISLPAGTRIWIAAGVTDMRCGFHGLAAKVQTALEENQLCGNVYIFRGRRGDLVKILWATEDGIWLLAKRLERGRFRWPK
ADGGKVHLSSAQLLMLLEGIDWRQPRRTAALSML

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-33 67
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-33 67
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 1e-32 67
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-33 67
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 1e-32 67
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-33 67
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-33 67
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-33 67
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-33 67
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-33 67
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 4e-30 67
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-33 66
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-33 66
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 1e-24 66
unnamed AAL08461.1 unknown Not tested SRL Protein 4e-33 65
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 2e-33 65
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 2e-33 65
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 7e-33 64
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 7e-33 64
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 1e-32 63
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 2e-29 59
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 2e-29 59
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 4e-28 58
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 4e-28 58
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-29 57

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC1002_6907 YP_003610217.1 IS66 Orf2 family protein VFG0792 Protein 8e-34 67
BC1002_6907 YP_003610217.1 IS66 Orf2 family protein VFG1709 Protein 8e-34 67
BC1002_6907 YP_003610217.1 IS66 Orf2 family protein VFG1698 Protein 5e-34 66
BC1002_6907 YP_003610217.1 IS66 Orf2 family protein VFG1517 Protein 4e-25 66
BC1002_6907 YP_003610217.1 IS66 Orf2 family protein VFG1052 Protein 2e-33 65
BC1002_6907 YP_003610217.1 IS66 Orf2 family protein VFG1665 Protein 6e-33 63
BC1002_6907 YP_003610217.1 IS66 Orf2 family protein VFG1737 Protein 9e-30 57