Gene Information

Name : BC1002_3737 (BC1002_3737)
Accession : YP_003607270.1
Strain :
Genome accession: NC_014118
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 594809 - 595480 bp
Length : 672 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator; KEGG: bxe:Bxe_B1748a hypothetical protein; SMART: response regulator receiver

DNA sequence :
ATGAGCATTCTGGTTATCGAAGACGATCCGAAAACCGGCGACTATCTGAAGAAGGGTCTGCGCGAGAACGGCTACGCGGT
CGACCTCGCGCGCACCGGCACGGACGGCCTGCATCTGGCGCTCGAGCACGACTACGAACTGGTGGTGCTCGACGTGATGC
TGCCCGGCATCGACGGTTGGGAAATCATGCGGGCGTTGCGTGCGCGACGCGATTTGCGGGTAATTTTCCTGACCGCGCGT
GATCAGGTCAGCGACCGCATTCGCGGTCTCGAACTCGGCGCCGACGACTATCTGGTCAAACCGTTTTCGTTTACCGAGCT
GGTGCTGCGCATTCGCACGTTGCTGCGCCGTGGCGTGATCCGCGAAAGCGACGTGTTCGAAGTCGCCGACTTGAAGCTCG
ACGTGTTGCGCCGCCGGGTCACGCGCGAAGGCGTCGACATTCCGCTGACCAACAAGGAGTTCATGCTGCTGCATCTGCTG
GTGCGCCGCGAGGGCGAAGCGCTGTCGCGCTCGCAGATCGCGTCGGAAGTGTGGGACATGAACTTCGATAGCGACACCAA
CGTGGTCGACGTGGCGATCAAGCGCTTGCGCGCGAAGGTCGATCACCCGTTCGAGAAGAAGCTGATTCACACCGTGCGCA
GCATCGGTTACACGTTCGGCGACAGCGCATGA

Protein sequence :
MSILVIEDDPKTGDYLKKGLRENGYAVDLARTGTDGLHLALEHDYELVVLDVMLPGIDGWEIMRALRARRDLRVIFLTAR
DQVSDRIRGLELGADDYLVKPFSFTELVLRIRTLLRRGVIRESDVFEVADLKLDVLRRRVTREGVDIPLTNKEFMLLHLL
VRREGEALSRSQIASEVWDMNFDSDTNVVDVAIKRLRAKVDHPFEKKLIHTVRSIGYTFGDSA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-59 58
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 6e-59 58

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC1002_3737 YP_003607270.1 transcriptional regulator BAC0197 Protein 2e-65 61
BC1002_3737 YP_003607270.1 transcriptional regulator BAC0083 Protein 1e-63 60
BC1002_3737 YP_003607270.1 transcriptional regulator BAC0125 Protein 2e-67 60
BC1002_3737 YP_003607270.1 transcriptional regulator BAC0111 Protein 2e-64 59
BC1002_3737 YP_003607270.1 transcriptional regulator BAC0308 Protein 5e-60 58
BC1002_3737 YP_003607270.1 transcriptional regulator BAC0638 Protein 4e-55 57
BC1002_3737 YP_003607270.1 transcriptional regulator BAC0347 Protein 4e-55 54
BC1002_3737 YP_003607270.1 transcriptional regulator NC_002952.2859858.p0 Protein 3e-39 42
BC1002_3737 YP_003607270.1 transcriptional regulator NC_007622.3794948.p0 Protein 3e-39 42
BC1002_3737 YP_003607270.1 transcriptional regulator NC_003923.1003417.p0 Protein 3e-39 42
BC1002_3737 YP_003607270.1 transcriptional regulator NC_013450.8614146.p0 Protein 3e-39 42
BC1002_3737 YP_003607270.1 transcriptional regulator NC_002951.3238224.p0 Protein 3e-39 42
BC1002_3737 YP_003607270.1 transcriptional regulator NC_007793.3914065.p0 Protein 3e-39 42
BC1002_3737 YP_003607270.1 transcriptional regulator NC_002758.1121390.p0 Protein 3e-39 42
BC1002_3737 YP_003607270.1 transcriptional regulator NC_010079.5776364.p0 Protein 3e-39 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC1002_3737 YP_003607270.1 transcriptional regulator VFG0596 Protein 4e-60 58
BC1002_3737 YP_003607270.1 transcriptional regulator VFG1389 Protein 4e-35 44
BC1002_3737 YP_003607270.1 transcriptional regulator VFG1390 Protein 1e-37 42