Gene Information

Name : BC1002_3543 (BC1002_3543)
Accession : YP_003607084.1
Strain :
Genome accession: NC_014118
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 376228 - 376914 bp
Length : 687 bp
Strand : +
Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator; KEGG: bpy:Bphyt_5873 two component heavy metal response transcriptional regulator, winged helix family; SMART: response regulator receiver

DNA sequence :

ATGAAATTGCTGATCGTTGAAGACGAGCACAAGGTAGTCGACTACCTGCGCTCCGGTTTGACAGAGCAGGGCTGGGTCGT
CGACGTCGCGCTCGACGGCGAGGAAGGGACGCATCTGGCCACCGAATTCGATTACGACGTGATCGTCCTCGACGTGATGC
TGCCCAAGCGCGACGGCTTCAGCGTGCTGAAGGCGCTGCGCATGCGCAAGTCGACGCCGGTCATCATGCTGACCGCGCGC
GATCACGTGAACGACCGCGTGCGCGGCTTGCGCGAAGGCGCGGACGACTACCTGACCAAACCGTTCTCGTTCCTCGAACT
CGTCGAGCGTCTGCATGCGCTCGCGCGCCGCACGCGATCGCAGGAGTCCACGCTGATTTCGGTCGGCGATCTGTTCGTCG
ATCTGATCGGCCGCCGTGCGACGCGCGATGGCGTGCGCCTCGACCTGACCGCGAAAGAGTTTCAACTGCTCAGCGTGCTC
GCGCGCCGCCAGGGCGACATTCTGTCGAAGACCGCGATCACCGAACTCGTATGGGACGTCAATTTCGACAGCCACACGAA
CGTCGTCGAAACCGCGATCAAACGGCTGCGCGCGAAACTCGACGGTCCATTTCCGTCGAAGCTGCTGCACACGGTGCGTG
GCATGGGCTACGTACTCGAAGTGCGCGAAGAGGCCGAGTCATCATGA

Protein sequence :

MKLLIVEDEHKVVDYLRSGLTEQGWVVDVALDGEEGTHLATEFDYDVIVLDVMLPKRDGFSVLKALRMRKSTPVIMLTAR
DHVNDRVRGLREGADDYLTKPFSFLELVERLHALARRTRSQESTLISVGDLFVDLIGRRATRDGVRLDLTAKEFQLLSVL
ARRQGDILSKTAITELVWDVNFDSHTNVVETAIKRLRAKLDGPFPSKLLHTVRGMGYVLEVREEAESS

• Homologs from PAI DB

Gene	GenBank Accn	Product	Virulance or Resistance	PAI or REI	Alignment Type	E-val	Identity
copR	NP_460069.2	transcriptional regulatory protein YedW	Not tested	SPI-5	Protein	1e-48	52
copR	AAC33719.1	regulatory protein CopR	Not tested	SPI-5	Protein	2e-47	50

• Homologs from CARD and BacMet (resistance genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
BC1002_3543	YP_003607084.1	transcriptional regulator	BAC0197	Protein	2e-57	56
BC1002_3543	YP_003607084.1	transcriptional regulator	BAC0083	Protein	1e-52	55
BC1002_3543	YP_003607084.1	transcriptional regulator	BAC0125	Protein	6e-58	55
BC1002_3543	YP_003607084.1	transcriptional regulator	BAC0638	Protein	3e-44	51
BC1002_3543	YP_003607084.1	transcriptional regulator	BAC0111	Protein	4e-53	51
BC1002_3543	YP_003607084.1	transcriptional regulator	BAC0308	Protein	2e-52	50
BC1002_3543	YP_003607084.1	transcriptional regulator	BAC0347	Protein	8e-47	47
BC1002_3543	YP_003607084.1	transcriptional regulator	CP000675.2.gene1535.	Protein	1e-31	41
BC1002_3543	YP_003607084.1	transcriptional regulator	NC_002952.2859905.p0	Protein	3e-32	41
BC1002_3543	YP_003607084.1	transcriptional regulator	NC_007622.3794472.p0	Protein	3e-32	41
BC1002_3543	YP_003607084.1	transcriptional regulator	NC_002745.1124361.p0	Protein	5e-32	41
BC1002_3543	YP_003607084.1	transcriptional regulator	NC_009782.5559369.p0	Protein	5e-32	41
BC1002_3543	YP_003607084.1	transcriptional regulator	NC_002951.3237708.p0	Protein	5e-32	41
BC1002_3543	YP_003607084.1	transcriptional regulator	NC_003923.1003749.p0	Protein	5e-32	41
BC1002_3543	YP_003607084.1	transcriptional regulator	NC_002758.1121668.p0	Protein	5e-32	41
BC1002_3543	YP_003607084.1	transcriptional regulator	NC_009641.5332272.p0	Protein	5e-32	41
BC1002_3543	YP_003607084.1	transcriptional regulator	NC_013450.8614421.p0	Protein	5e-32	41
BC1002_3543	YP_003607084.1	transcriptional regulator	NC_007793.3914279.p0	Protein	5e-32	41

• Homologs from VFDB (virulence genes)

Gene	GenBank Accn	Product	ID of source DB	Alignment Type	E-val	Identity
BC1002_3543	YP_003607084.1	transcriptional regulator	VFG0596	Protein	5e-49	52
BC1002_3543	YP_003607084.1	transcriptional regulator	VFG1389	Protein	2e-37	50