
|
Name : BC1002_0008 (BC1002_0008) Accession : YP_003603632.1 Strain : Genome accession: NC_014117 Putative virulence/resistance : Resistance Product : transcriptional regulator, MerR family Function : - COG functional category : K : Transcription COG ID : COG0789 EC number : - Position : 11934 - 12365 bp Length : 432 bp Strand : + Note : TIGRFAM: Cd(II)/Pb(II)-responsive transcriptional regulator; PFAM: transcription regulator MerR DNA binding; regulatory protein MerR; KEGG: bpy:Bphyt_0028 transcriptional regulator, MerR family; SMART: regulatory protein MerR DNA sequence : ATGAAAATCGGCGAACTGGCGAAAATCGCCCATTGCACGACGGAAACCATCCGTTTCTACGAGAAAGAGCGCCTGCTGCC CGAGGCGGAGCGCACCGAGGCCAATTACCGCAGTTACACGGCAAAGCATGTCGAGCGCCTGCGTTTCATCCGCAATTGCC GCGCGCTCGACATGACCCACGACGAAATCCGCGCCTTGCTGCGTCTGACCGACGCGCCGGCGAACGGCTGCGGCGGCATG CATGCGCTGATAGACGAGCACGTCGCGCACGTCGACACGCGTATCGAAGAACTGCAGCAGCTGAAGGCGCAACTGACAAC GCTGCGTGACCAATGCCACGGCGAGCATCCGGTCGAAGACTGCGGCATCGTGCACGGCCTGACCGACATGGATGTGGCCG TGCCGCGTCCGCGGCATACGCATCTCGGCTGA Protein sequence : MKIGELAKIAHCTTETIRFYEKERLLPEAERTEANYRSYTAKHVERLRFIRNCRALDMTHDEIRALLRLTDAPANGCGGM HALIDEHVAHVDTRIEELQQLKAQLTTLRDQCHGEHPVEDCGIVHGLTDMDVAVPRPRHTHLG |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| ORF C98 | AAN62191.1 | putative transcriptional regulator | Not tested | PAGI-2(C) | Protein | 9e-32 | 51 |
| ACICU_00234 | YP_001844893.1 | transcriptional regulator | Not tested | AbaR20 | Protein | 2e-31 | 48 |
| pbrR | CAJ77094.1 | Transcriptional regulator | Not tested | AbaR1 | Protein | 1e-31 | 48 |
| cadR | AGK36653.1 | MerR family transcriptional regulator | Not tested | AbaR26 | Protein | 1e-31 | 48 |
| cadR | ACN81029.1 | MerR family transcriptional regulator | Not tested | AbaR5 | Protein | 2e-31 | 48 |
| cadR | ADZ05769.1 | MerR family transcriptional regulator | Not tested | AbaR11 | Protein | 4e-31 | 47 |
| cadR | ACS32041.1 | MerR family transcriptional regulator | Not tested | AbaR5 | Protein | 6e-31 | 47 |
| pbrR | CAJ77021.1 | transcription regulator | Not tested | AbaR1 | Protein | 3e-31 | 47 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| BC1002_0008 | YP_003603632.1 | transcriptional regulator, MerR family | BAC0301 | Protein | 2e-33 | 60 |
| BC1002_0008 | YP_003603632.1 | transcriptional regulator, MerR family | BAC0058 | Protein | 7e-40 | 56 |