Gene Information

Name : BC1002_2527 (BC1002_2527)
Accession : YP_003606087.1
Strain :
Genome accession: NC_014117
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2817786 - 2818448 bp
Length : 663 bp
Strand : -
Note : KEGG: bpy:Bphyt_3267 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGCGCATCCTGCTAGTCGAAGATGACCGGATGATCGCCGAAGGCGTGCGCAAGGCGCTGCGCGGCGAAGGCTTCGCCGT
CGATTGGGTCGAGGACGGCGAAGCGGCGCTGCACGCGGCGGCCGCCCAGCCTTACGACCTCGCGTTGCTCGATCTCGGTC
TGCCCAAGCGCGACGGTCTCGAGGTGCTGCGGGCACTGCGCGCGCGCGGCAATGCGCTGCCGGTGCTGATCGTCACCGCG
CGCGACGCGGTCGCCGATCGTGTCAAAGGCCTCGACGCCGGCGCTGACGATTACCTTGTCAAACCTTTCGATCTCGACGA
GCTCGGCGCCCGCATGAGAGCGCTGATCCGGCGACAGTCCGGCCGCAGCGATTCGACGATTCGCCACGGCAACTTGACCC
TCGATCCCGCGTCGCACCAGGTGACGCTCGATGGCGCGCCGGTCGCGCTATCCGCGCGGGAATTCGCGTTGCTCGAAGCG
CTGCTCGCTCGGCCCGGCGCGGTGCTGTCCAAGAGCCAACTCGAGGAAAAGATGTACGGCTGGGGCGAGGAGATCGGCAG
CAACACCGTCGAGGTGTATATCCACGCGCTGCGCAAGAAGCTCGGCGCCGATCTGATCCGCAACGTGCGCGGGCTGGGCT
ACATGATCGCGAAGGACGCCTGA

Protein sequence :
MRILLVEDDRMIAEGVRKALRGEGFAVDWVEDGEAALHAAAAQPYDLALLDLGLPKRDGLEVLRALRARGNALPVLIVTA
RDAVADRVKGLDAGADDYLVKPFDLDELGARMRALIRRQSGRSDSTIRHGNLTLDPASHQVTLDGAPVALSAREFALLEA
LLARPGAVLSKSQLEEKMYGWGEEIGSNTVEVYIHALRKKLGADLIRNVRGLGYMIAKDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-36 51
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-22 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-21 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC1002_2527 YP_003606087.1 two component transcriptional regulator, winged helix family BAC0487 Protein 4e-33 49
BC1002_2527 YP_003606087.1 two component transcriptional regulator, winged helix family BAC0197 Protein 2e-27 45
BC1002_2527 YP_003606087.1 two component transcriptional regulator, winged helix family BAC0083 Protein 6e-25 44
BC1002_2527 YP_003606087.1 two component transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 9e-26 44
BC1002_2527 YP_003606087.1 two component transcriptional regulator, winged helix family BAC0638 Protein 6e-23 43
BC1002_2527 YP_003606087.1 two component transcriptional regulator, winged helix family U82965.2.orf14.gene. Protein 3e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC1002_2527 YP_003606087.1 two component transcriptional regulator, winged helix family VFG0473 Protein 3e-34 48
BC1002_2527 YP_003606087.1 two component transcriptional regulator, winged helix family VFG1390 Protein 4e-32 47
BC1002_2527 YP_003606087.1 two component transcriptional regulator, winged helix family VFG1389 Protein 9e-23 44
BC1002_2527 YP_003606087.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-22 42