Gene Information

Name : ECL_A052 (ECL_A052)
Accession : YP_003602548.1
Strain :
Genome accession: NC_014107
Putative virulence/resistance : Unknown
Product : IS911 transposase orfA
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 40064 - 40375 bp
Length : 312 bp
Strand : -
Note : -

DNA sequence :
ATGAACAAGAAAACCAAACGAACCTTCCCCCCTGAGTTCAGGCTGGAATGTGCACAGCTGATTGTTGATAAGGGCTACTC
ATATCGACAGGCCAGTGAAGCGATGAATGTCGGTTCAACCACGCTTGAGAGCTGGGTACGCCAGCTCAGGCGAGAGCGCC
AGGGGATTACGCCCTCTGCCACACCCATTACTCCAGACCAGCAACGTATCCGCGAGCTGGAAAAGCAAGTTCGCCGTCTG
GAGGAACAAAATACGATATTAAAAAAGGCTACCGCGCTCTTAATGTCCGACTCGCTGAACGGTTCACGATAG

Protein sequence :
MNKKTKRTFPPEFRLECAQLIVDKGYSYRQASEAMNVGSTTLESWVRQLRRERQGITPSATPITPDQQRIRELEKQVRRL
EEQNTILKKATALLMSDSLNGSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 4e-43 99
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 6e-43 99
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 1e-41 97
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 7e-42 97
unnamed AAC31483.1 L0004 Not tested LEE Protein 5e-42 97
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 7e-42 97
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-28 64
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-28 64
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-28 64
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-28 64
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-28 64
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-28 64
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-28 64
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-28 64
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 3e-24 62
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-24 61
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-24 61
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-19 56
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 1e-22 53
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 6e-22 51
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 4e-20 51
tnpA CAB61575.1 transposase A Not tested HPI Protein 1e-19 50

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECL_A052 YP_003602548.1 IS911 transposase orfA VFG0784 Protein 2e-42 97
ECL_A052 YP_003602548.1 IS911 transposase orfA VFG1123 Protein 7e-29 64
ECL_A052 YP_003602548.1 IS911 transposase orfA VFG1485 Protein 6e-25 61
ECL_A052 YP_003602548.1 IS911 transposase orfA VFG1553 Protein 6e-23 53