Gene Information

Name : merD (ECL_A046)
Accession : YP_003602542.1
Strain :
Genome accession: NC_014107
Putative virulence/resistance : Resistance
Product : mercuric resistance transcriptional repressor protein MerD
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 37199 - 37564 bp
Length : 366 bp
Strand : +
Note : -

DNA sequence :
ATGAGCGCCTACACAGTGTCCCGGCTGGCCCTTGATGCCGGGGTGAGCGTGCATATCGTGCGCGACTACCTGCTGCGCGG
ATTGCTACGGCCGGTCGCGTGCACCACGGGCGGCTACGGCTTGTTCGATGACACCGCGTTGCAACGGCTGCGCTTTGTAC
GGGCTGCCTTCGAAGCGGGTATCGGCCTGGACGCACTGGCGCGGCTGTGCCGGGCGCTGGATGCTGCGGACGGTGACGGT
GCGTCTGCGCAGCTTGCCGTGTTGCGGCAACTCGTCGAGCGTCGGCGCGAGGCCCTGGCCAGCCTCGAAATGCAACTGGC
CGCCATGCCAACCGAACCGGCACAGCACGCGGAGAGTCTGCCATGA

Protein sequence :
MSAYTVSRLALDAGVSVHIVRDYLLRGLLRPVACTTGGYGLFDDTALQRLRFVRAAFEAGIGLDALARLCRALDAADGDG
ASAQLAVLRQLVERRREALASLEMQLAAMPTEPAQHAESLP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merD ACN81004.1 MerD Not tested AbaR5 Protein 5e-35 99
merD CAJ77059.1 Mercury operon coregulator protein Not tested AbaR1 Protein 6e-35 99
merD AGK07020.1 MerD Not tested SGI1 Protein 2e-32 91
merD AGK07078.1 MerD Not tested SGI1 Protein 2e-32 91
merD ABQ57370.1 MerD Not tested SGI1 Protein 5e-32 90
merD AET25396.1 MerD Not tested PAGI-2(C) Protein 2e-28 84
merD AFG30119.1 MerD Not tested PAGI-2 Protein 2e-28 84
merD YP_006098386.1 MerR family transcriptional regulator Not tested Tn2411 Protein 3e-28 84
merD ACF06181.1 mercuric resistance protein Not tested Tn5036-like Protein 2e-28 84

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merD YP_003602542.1 mercuric resistance transcriptional repressor protein MerD BAC0668 Protein 1e-32 91
merD YP_003602542.1 mercuric resistance transcriptional repressor protein MerD BAC0665 Protein 1e-33 91
merD YP_003602542.1 mercuric resistance transcriptional repressor protein MerD BAC0666 Protein 8e-33 91
merD YP_003602542.1 mercuric resistance transcriptional repressor protein MerD BAC0667 Protein 2e-34 90
merD YP_003602542.1 mercuric resistance transcriptional repressor protein MerD BAC0227 Protein 2e-32 90
merD YP_003602542.1 mercuric resistance transcriptional repressor protein MerD BAC0669 Protein 1e-33 85