Gene Information

Name : merP (ECL_A043)
Accession : YP_003602539.1
Strain :
Genome accession: NC_014107
Putative virulence/resistance : Resistance
Product : mercuric transport protein periplasmic component MerP
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 34750 - 35025 bp
Length : 276 bp
Strand : +
Note : -

DNA sequence :
ATGAAAAAACTGTTTGCCGCCCTCGCCCTCGCTGCCGTTGTTGCCCCCGTGTGGGCCGCCACCCAGACCGTCACGCTGTC
CGTACCGGGCATGACCTGCTCCACCTGCCCGATCACCGTCAAGAAGGCGATTTCCAAGGTCGAAGGCGTCAGCAAAATTG
ACGTGACCTTCGAGACACGCGAAGCGGTTGTCACGTTCGATGATGCCAAGACCAGCGTGCAGAAGCTGACCAAGGCAACC
GGAGACGCGGGCTATCCGTCCAGCGTCAAGCAGTGA

Protein sequence :
MKKLFAALALAAVVAPVWAATQTVTLSVPGMTCSTCPITVKKAISKVEGVSKIDVTFETREAVVTFDDAKTSVQKLTKAT
GDAGYPSSVKQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AGK07081.1 MerP Not tested SGI1 Protein 3e-24 86
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 4e-24 86
merP ABQ57373.1 MerP Not tested SGI1 Protein 3e-24 86
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 3e-24 86
merP AFG30122.1 MerP Not tested PAGI-2 Protein 3e-24 86
merP AGK07023.1 MerP Not tested SGI1 Protein 3e-24 86
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 3e-23 82
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 5e-23 82
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 1e-22 77
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 3e-21 75

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merP YP_003602539.1 mercuric transport protein periplasmic component MerP BAC0678 Protein 7e-26 95
merP YP_003602539.1 mercuric transport protein periplasmic component MerP BAC0679 Protein 8e-26 95
merP YP_003602539.1 mercuric transport protein periplasmic component MerP BAC0231 Protein 3e-25 93
merP YP_003602539.1 mercuric transport protein periplasmic component MerP BAC0675 Protein 6e-21 74
merP YP_003602539.1 mercuric transport protein periplasmic component MerP BAC0674 Protein 7e-17 61