Gene Information

Name : resD (BMD_4354)
Accession : YP_003599534.1
Strain : Bacillus megaterium DSM 319
Genome accession: NC_014103
Putative virulence/resistance : Virulence
Product : two-component response regulator ResD
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4212081 - 4212797 bp
Length : 717 bp
Strand : -
Note : -

DNA sequence :
ATGCAAAACGAACAAAGATTACTGCTAGTAGACGATGAAGATCGCATTAGACGATTGTTAAAAATGTACTTAGAAAAAGA
AGGATACATCATTGAAGAAGCAGCAGATGGGCATGAAGCAATCGAAAAAGCGTTACACATAGACTATGATTTGATTGTAT
TGGATTTAATGATGCCCGGCATAGATGGTATTGAGGCTTGTAAACAAATTCGGGAGAAAAAAGCAACTCCTATTATCATG
CTTACAGCCAAAGGGGAAGAAGTAAACAGAGTCCAAGGGTTTGAAGTAGGTACAGATGATTATATCGTTAAGCCGTTTAG
CCCAAGAGAAGTGGTGCTTCGCGTAAAAGCACTGCTTCGACGTTCTTCTCAAGCAACGTTTATTCAACCAGAAACGAGCG
TGAAAAATCTTATCGTCTTTGATCACTTAACGATTGATAATGATGCACATCGCGTTACAGCAGACGGAAAAGAAGTTAAC
TTAACTCCAAAAGAATATGAATTATTATGCTACCTTGCAAAAACGCCAGATAAAGTATATGACAGAGAACAGCTGCTGCG
TGAAGTATGGCATTATGATTTCTTTGGAGATCTTCGTACGGTAGATACGCACGTCAAGCGTTTGCGTGAAAAGTTAAATC
GTGTATCGTCACAAGCGGCGAAAATGATTGTAACCGTATGGGGAGTAGGGTATAAATTTGAGGTTGAAAATAACTGA

Protein sequence :
MQNEQRLLLVDDEDRIRRLLKMYLEKEGYIIEEAADGHEAIEKALHIDYDLIVLDLMMPGIDGIEACKQIREKKATPIIM
LTAKGEEVNRVQGFEVGTDDYIVKPFSPREVVLRVKALLRRSSQATFIQPETSVKNLIVFDHLTIDNDAHRVTADGKEVN
LTPKEYELLCYLAKTPDKVYDREQLLREVWHYDFFGDLRTVDTHVKRLREKLNRVSSQAAKMIVTVWGVGYKFEVENN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-39 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_003599534.1 two-component response regulator ResD NC_002952.2859905.p0 Protein 9e-45 48
resD YP_003599534.1 two-component response regulator ResD NC_003923.1003749.p0 Protein 1e-44 48
resD YP_003599534.1 two-component response regulator ResD NC_002758.1121668.p0 Protein 1e-44 48
resD YP_003599534.1 two-component response regulator ResD NC_007622.3794472.p0 Protein 8e-45 48
resD YP_003599534.1 two-component response regulator ResD NC_009641.5332272.p0 Protein 1e-44 48
resD YP_003599534.1 two-component response regulator ResD NC_013450.8614421.p0 Protein 1e-44 48
resD YP_003599534.1 two-component response regulator ResD NC_007793.3914279.p0 Protein 1e-44 48
resD YP_003599534.1 two-component response regulator ResD NC_002745.1124361.p0 Protein 1e-44 48
resD YP_003599534.1 two-component response regulator ResD NC_009782.5559369.p0 Protein 1e-44 48
resD YP_003599534.1 two-component response regulator ResD NC_002951.3237708.p0 Protein 1e-44 48
resD YP_003599534.1 two-component response regulator ResD NC_012469.1.7685629. Protein 7e-42 47
resD YP_003599534.1 two-component response regulator ResD HE999704.1.gene2815. Protein 2e-45 47
resD YP_003599534.1 two-component response regulator ResD AE016830.1.gene1681. Protein 2e-46 45
resD YP_003599534.1 two-component response regulator ResD AF155139.2.orf0.gene Protein 2e-43 44
resD YP_003599534.1 two-component response regulator ResD NC_003923.1003417.p0 Protein 3e-42 43
resD YP_003599534.1 two-component response regulator ResD NC_013450.8614146.p0 Protein 3e-42 43
resD YP_003599534.1 two-component response regulator ResD NC_002951.3238224.p0 Protein 3e-42 43
resD YP_003599534.1 two-component response regulator ResD NC_007793.3914065.p0 Protein 3e-42 43
resD YP_003599534.1 two-component response regulator ResD NC_002758.1121390.p0 Protein 3e-42 43
resD YP_003599534.1 two-component response regulator ResD NC_010079.5776364.p0 Protein 3e-42 43
resD YP_003599534.1 two-component response regulator ResD NC_002952.2859858.p0 Protein 3e-42 43
resD YP_003599534.1 two-component response regulator ResD NC_007622.3794948.p0 Protein 3e-42 43
resD YP_003599534.1 two-component response regulator ResD CP004022.1.gene1676. Protein 4e-37 43
resD YP_003599534.1 two-component response regulator ResD FJ349556.1.orf0.gene Protein 1e-42 43
resD YP_003599534.1 two-component response regulator ResD AE015929.1.gene1106. Protein 2e-36 42
resD YP_003599534.1 two-component response regulator ResD AM180355.1.gene1830. Protein 1e-38 42
resD YP_003599534.1 two-component response regulator ResD NC_012469.1.7686381. Protein 2e-41 42
resD YP_003599534.1 two-component response regulator ResD AF130997.1.orf0.gene Protein 1e-36 41
resD YP_003599534.1 two-component response regulator ResD DQ212986.1.gene4.p01 Protein 4e-38 41
resD YP_003599534.1 two-component response regulator ResD CP000034.1.gene2186. Protein 1e-36 41
resD YP_003599534.1 two-component response regulator ResD NC_002695.1.916589.p Protein 1e-36 41
resD YP_003599534.1 two-component response regulator ResD BAC0596 Protein 1e-35 41
resD YP_003599534.1 two-component response regulator ResD BAC0039 Protein 1e-36 41
resD YP_003599534.1 two-component response regulator ResD CP001138.1.gene2239. Protein 1e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
resD YP_003599534.1 two-component response regulator ResD VFG1563 Protein 2e-39 41
resD YP_003599534.1 two-component response regulator ResD VFG1702 Protein 5e-39 41