Gene Information

Name : BMD_2686 (BMD_2686)
Accession : YP_003597880.1
Strain : Bacillus megaterium DSM 319
Genome accession: NC_014103
Putative virulence/resistance : Resistance
Product : Tellurium resistance protein terD,TerD family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2663969 - 2664547 bp
Length : 579 bp
Strand : -
Note : -

DNA sequence : 
ATGGCTATTAATCTTTCAAAAGGACAAAAAGTAGATTTAACAAAAACGAATCCAGGATTAACAAACGTAGTAGTAGGTCT
TGGATGGGATGTAAATAAGTATGACGGTGGAAACGATTTTGATTTAGATTCATCTGTCTTTTTATTAAACGAAGCGGGAA
AATGCGCTTCAGAATCTGATTTTATTTTTTACAATAATACGACGGGTGCAAACGGAGCGGTTGAGCATACCGGAGATAAC
CGTACAGGCGTAGGTGAAGGAGACGATGAGCAGGTTCAAGTAGACTTGAAAAATGTGCCTCAATCTATTGAACGTATCGC
GTTTACCATTACGATTCATGAAGCGGAAGCGCGCGGTCAAAACTTTGGCCAAGTAAGCAATGCCTACGTTCGTATTTTAA
ATGCAACAAATGACGAAGAGTTAATTCGTTATGATTTAGGTGAAGACTTCTCGATCGAAACAGCCGTTGTAGTAGGAGAG
CTGTACCGACACGGCGGAGAATGGAAGTTTAATGCTATTGGGAGCGGTTATCAAGGCGGCTTAGCGGCACTTGTCAACGA
CTTTGGTTTAAACGCCTAA

Protein sequence : 
MAINLSKGQKVDLTKTNPGLTNVVVGLGWDVNKYDGGNDFDLDSSVFLLNEAGKCASESDFIFYNNTTGANGAVEHTGDN
RTGVGEGDDEQVQVDLKNVPQSIERIAFTITIHEAEARGQNFGQVSNAYVRILNATNDEELIRYDLGEDFSIETAVVVGE
LYRHGGEWKFNAIGSGYQGGLAALVNDFGLNA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-55 58
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-53 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-53 57
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 9e-53 56
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-49 55
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-49 55
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-49 55
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-51 54
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMD_2686 YP_003597880.1 Tellurium resistance protein terD,TerD family BAC0390 Protein 4e-53 56
BMD_2686 YP_003597880.1 Tellurium resistance protein terD,TerD family BAC0389 Protein 1e-52 56