Gene Information

Name : ykoG (BMD_1764)
Accession : YP_003596967.1
Strain : Bacillus megaterium DSM 319
Genome accession: NC_014103
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1757804 - 1758523 bp
Length : 720 bp
Strand : -
Note : -

DNA sequence : 
ATGAAAAAAAGCATTTTAATTATTGAAGATGAAGTAAGGATTGCACGAGCACTTCAAATTGAACTTGAGCATGAAGGATA
CCAAGTACTTGTTGTGCACGAAGGGAAAACCGGCCTTGAAACTGCCTTAAATAGTAGCATTGATTTGATTTTATTAGACG
TTATGCTTCCAGGTCTAAATGGAATTGAAGTTCTTCGAAGAATTAGAAAAAAAGACATCTACTTGCCCATTATTCTTTTG
ACAGCTCGTGACACCACATTAGATAAAGTGATGGGGCTAGATCATGGGGCGAATGATTATATCACCAAGCCATTTGAAAT
AGAGGAAGTATTAGCTAGGGTACGCAATAGTCTTCGTCATAGAGCTATCGTTCAGGATGTTAGTGAAAAAAAAGATGTTC
ACTTATCAATAGAAGATTTATCTGTGAATTTAGAAACTAGAGATGTAATTAGAAAAAACAAGCAGATTATATTAACATCA
AAAGAATATGATTTGCTTGTACATTTATTAAAAAATAAAAATATTGTACTAAGCAGGGACAATATTCTCTTGACCGTCTG
GGGCTATGATTATGAGGGGGAAACTAATGTGGTGGATGTGTTCATCGGGCATTTAAGAAAGAAACTAGAAGAAGATACTA
CATCCTCTTTAATCCAAACCATCCGAGGAGTAGGATATGTGATAAGAAAGGATCAACATGAAAATCACCACCAAAGTTAA

Protein sequence : 
MKKSILIIEDEVRIARALQIELEHEGYQVLVVHEGKTGLETALNSSIDLILLDVMLPGLNGIEVLRRIRKKDIYLPIILL
TARDTTLDKVMGLDHGANDYITKPFEIEEVLARVRNSLRHRAIVQDVSEKKDVHLSIEDLSVNLETRDVIRKNKQIILTS
KEYDLLVHLLKNKNIVLSRDNILLTVWGYDYEGETNVVDVFIGHLRKKLEEDTTSSLIQTIRGVGYVIRKDQHENHHQS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-35 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_003596967.1 two-component response regulator AE015929.1.gene1106. Protein 8e-42 50
ykoG YP_003596967.1 two-component response regulator HE999704.1.gene1528. Protein 2e-44 50
ykoG YP_003596967.1 two-component response regulator NC_002952.2859858.p0 Protein 3e-45 49
ykoG YP_003596967.1 two-component response regulator NC_007622.3794948.p0 Protein 3e-45 49
ykoG YP_003596967.1 two-component response regulator NC_003923.1003417.p0 Protein 3e-45 49
ykoG YP_003596967.1 two-component response regulator NC_013450.8614146.p0 Protein 3e-45 49
ykoG YP_003596967.1 two-component response regulator NC_002951.3238224.p0 Protein 3e-45 49
ykoG YP_003596967.1 two-component response regulator NC_007793.3914065.p0 Protein 3e-45 49
ykoG YP_003596967.1 two-component response regulator NC_002758.1121390.p0 Protein 3e-45 49
ykoG YP_003596967.1 two-component response regulator NC_010079.5776364.p0 Protein 3e-45 49
ykoG YP_003596967.1 two-component response regulator BAC0308 Protein 1e-39 44
ykoG YP_003596967.1 two-component response regulator AF155139.2.orf0.gene Protein 3e-38 44
ykoG YP_003596967.1 two-component response regulator FJ349556.1.orf0.gene Protein 2e-35 43
ykoG YP_003596967.1 two-component response regulator HE999704.1.gene2815. Protein 2e-44 43
ykoG YP_003596967.1 two-component response regulator BAC0638 Protein 2e-36 42
ykoG YP_003596967.1 two-component response regulator BAC0083 Protein 9e-39 41
ykoG YP_003596967.1 two-component response regulator BAC0125 Protein 2e-39 41
ykoG YP_003596967.1 two-component response regulator BAC0111 Protein 2e-37 41
ykoG YP_003596967.1 two-component response regulator BAC0197 Protein 4e-37 41
ykoG YP_003596967.1 two-component response regulator NC_002952.2859905.p0 Protein 7e-44 41
ykoG YP_003596967.1 two-component response regulator AE016830.1.gene1681. Protein 2e-44 41
ykoG YP_003596967.1 two-component response regulator AE000516.2.gene3505. Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_003596967.1 two-component response regulator VFG1390 Protein 1e-43 42
ykoG YP_003596967.1 two-component response regulator VFG0596 Protein 6e-36 41