Gene Information

Name : ykoG (BMD_1642)
Accession : YP_003596848.1
Strain : Bacillus megaterium DSM 319
Genome accession: NC_014103
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1629372 - 1630091 bp
Length : 720 bp
Strand : -
Note : -

DNA sequence :
ATGCAAAACCGTATTTTAATCGTTGAAGATGAAGAAATGATTGCACGAGCTCTTCAAATTGAGCTTGAACATGAAGGATA
CAAAGTATTCGTAGAGCATGAAGGAAAAAGCGGCCTTGAAGCTGCTTTACATAATAGCATTGATCTAGTTTTACTAGACG
TTATGCTTCCAGAACTTAGCGGTATCGAAGTCCTTCGAAGAATTAGAAAAAAGAACGCCTATCTCCCTGTTATTCTTTTG
ACAGCCCGTGACACTACGCTAGATAAAGTGATGGGACTAGATCACGGAGCAAATGATTACATCACCAAGCCCTTCGAAAT
AGAAGAAGTATTAGCTAGGGTGCGCAATAGTCTTCGCCATGGAGCTATCATTCAAGAAGTTACTGAAAAAAAAGATGTTC
ATTTATCAATAGAAGATTTATCTGTGAATTTAGAGACCAGAGAAGTGATAAGAAAAAACAAAACGATTATACTAACCCCG
AAAGAATATGATTTGCTTGTTTATTTACTAAAAAATCAAAATATAGTACTGAGCAGAGAAAATATCCTCTTGACCGTTTG
GGGCTACGATTATGAAGGAGAAACAAACGTAGTAGATGTGTATATTGGACATTTGAGAAAGAAAATAGAAGAAGAGATTA
ACTCTCCCTTGATTCGCACCGTCAGAGGAGTAGGATATGTGATAAGAAAGGAACCATATGAAAATTACTACCAAGGTTAA

Protein sequence :
MQNRILIVEDEEMIARALQIELEHEGYKVFVEHEGKSGLEAALHNSIDLVLLDVMLPELSGIEVLRRIRKKNAYLPVILL
TARDTTLDKVMGLDHGANDYITKPFEIEEVLARVRNSLRHGAIIQEVTEKKDVHLSIEDLSVNLETREVIRKNKTIILTP
KEYDLLVYLLKNQNIVLSRENILLTVWGYDYEGETNVVDVYIGHLRKKIEEEINSPLIRTVRGVGYVIRKEPYENYYQG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_003596848.1 two-component response regulator HE999704.1.gene1528. Protein 9e-45 51
ykoG YP_003596848.1 two-component response regulator AE015929.1.gene1106. Protein 6e-39 50
ykoG YP_003596848.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-42 49
ykoG YP_003596848.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-42 49
ykoG YP_003596848.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-42 49
ykoG YP_003596848.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-42 49
ykoG YP_003596848.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-42 49
ykoG YP_003596848.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-42 49
ykoG YP_003596848.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-42 49
ykoG YP_003596848.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-42 49
ykoG YP_003596848.1 two-component response regulator BAC0308 Protein 8e-39 44
ykoG YP_003596848.1 two-component response regulator HE999704.1.gene2815. Protein 2e-45 44
ykoG YP_003596848.1 two-component response regulator FJ349556.1.orf0.gene Protein 1e-34 43
ykoG YP_003596848.1 two-component response regulator BAC0638 Protein 1e-36 43
ykoG YP_003596848.1 two-component response regulator AE016830.1.gene1681. Protein 2e-43 43
ykoG YP_003596848.1 two-component response regulator NC_002952.2859905.p0 Protein 5e-46 43
ykoG YP_003596848.1 two-component response regulator NC_007622.3794472.p0 Protein 6e-46 43
ykoG YP_003596848.1 two-component response regulator NC_002758.1121668.p0 Protein 1e-45 43
ykoG YP_003596848.1 two-component response regulator NC_009641.5332272.p0 Protein 1e-45 43
ykoG YP_003596848.1 two-component response regulator NC_013450.8614421.p0 Protein 1e-45 43
ykoG YP_003596848.1 two-component response regulator NC_007793.3914279.p0 Protein 1e-45 43
ykoG YP_003596848.1 two-component response regulator NC_003923.1003749.p0 Protein 1e-45 43
ykoG YP_003596848.1 two-component response regulator NC_002745.1124361.p0 Protein 1e-45 43
ykoG YP_003596848.1 two-component response regulator NC_009782.5559369.p0 Protein 1e-45 43
ykoG YP_003596848.1 two-component response regulator NC_002951.3237708.p0 Protein 1e-45 43
ykoG YP_003596848.1 two-component response regulator AF155139.2.orf0.gene Protein 6e-37 43
ykoG YP_003596848.1 two-component response regulator BAC0125 Protein 1e-38 42
ykoG YP_003596848.1 two-component response regulator BAC0083 Protein 1e-39 42
ykoG YP_003596848.1 two-component response regulator NC_012469.1.7686381. Protein 7e-44 42
ykoG YP_003596848.1 two-component response regulator BAC0197 Protein 1e-37 42
ykoG YP_003596848.1 two-component response regulator AE000516.2.gene3505. Protein 5e-34 42
ykoG YP_003596848.1 two-component response regulator NC_005054.2598277.p0 Protein 3e-36 41
ykoG YP_003596848.1 two-component response regulator AM180355.1.gene1830. Protein 4e-36 41
ykoG YP_003596848.1 two-component response regulator NC_014475.1.orf0.gen Protein 3e-36 41
ykoG YP_003596848.1 two-component response regulator BAC0347 Protein 5e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ykoG YP_003596848.1 two-component response regulator VFG1390 Protein 3e-44 43
ykoG YP_003596848.1 two-component response regulator VFG0596 Protein 2e-36 41
ykoG YP_003596848.1 two-component response regulator VFG1386 Protein 3e-44 41