Gene Information

Name : Cseg_3862 (Cseg_3862)
Accession : YP_003594900.1
Strain : Caulobacter segnis ATCC 21756
Genome accession: NC_014100
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4238622 - 4239314 bp
Length : 693 bp
Strand : -
Note : TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: cak:Caul_4546 two component transcriptional regulator; SMART: response regulator receiver

DNA sequence :
GTGACTCCCTACGTCCTGGTGGTCGAAGACGAAGACGCCCTGGCCACCCTGCTCCACTACAATCTCGACAAGGAAGGCTA
CCGCGTCGCCGTCGCCGGCGATGGCGAGGAAGCCCTGACCCTGGCCAGCGAACGCGCGCCGGACCTCGTGATCCTCGACT
GGATGCTGCCCAAGGTGTCGGGCATCGAGGTCTGCCGCCGCCTGCGCGGCCGGGCCGAGACCCGCAATGTGCCGATCATC
ATGCTGACGGCGCGCGGCGAGGAGAGCGATCGCATCCGCGGCCTCGACACCGGCGCCGATGACTACGTGGTCAAGCCGTT
CTCGATGGTCGAGCTGACCGCCCGCGTCCGGGCCGTCATGCGCCGCATCCGTCCGGGCCTGGCCGACGACCGCATCACGG
TCGGCGACATCGTGATCGACCGCGTCGCCCACCGCGTGAAGCGGAACGGCAAGGAGATCCACCTGGGCCCGACCGAGTTC
CGCCTGCTCGACTATCTGATGCAGCACCCGGGCCGGGTGTTCAGCCGCGAACAGCTGCTGGACGCGGTCTGGGGTTCGGA
CGTCTATGTCGAGGCCCGCACGGTCGACGTCCACATCGGCCGCCTGCGCAAGGCGCTCAACGGCTCGTCCGACGGCGACC
CGATCCGCACCGTGCGCTCGGCCGGCTATTCGCTGGACCTGGACGCGGCCTAG

Protein sequence :
MTPYVLVVEDEDALATLLHYNLDKEGYRVAVAGDGEEALTLASERAPDLVILDWMLPKVSGIEVCRRLRGRAETRNVPII
MLTARGEESDRIRGLDTGADDYVVKPFSMVELTARVRAVMRRIRPGLADDRITVGDIVIDRVAHRVKRNGKEIHLGPTEF
RLLDYLMQHPGRVFSREQLLDAVWGSDVYVEARTVDVHIGRLRKALNGSSDGDPIRTVRSAGYSLDLDAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-35 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-44 46
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-44 46
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-44 46
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-44 46
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-44 46
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-44 46
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-44 46
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-44 46
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-44 46
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-44 46
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 7e-42 45
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-39 44
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-39 44
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-39 44
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-39 44
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-39 44
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-39 44
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-39 44
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-39 44
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 7e-36 43
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-37 43
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-41 42
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-38 42
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-36 41
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 2e-36 41
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-36 41
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 2e-33 41
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-33 41
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 5e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-40 42
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator VFG1702 Protein 5e-36 42
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator VFG1563 Protein 4e-35 41
Cseg_3862 YP_003594900.1 winged helix family two component transcriptional regulator VFG1389 Protein 7e-33 41