Gene Information

Name : Cseg_2459 (Cseg_2459)
Accession : YP_003593532.1
Strain : Caulobacter segnis ATCC 21756
Genome accession: NC_014100
Putative virulence/resistance : Resistance
Product : arsenate reductase
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : -
Position : 2700628 - 2701053 bp
Length : 426 bp
Strand : -
Note : KEGG: ccs:CCNA_01571 arsenate reductase; TIGRFAM: arsenate reductase; PFAM: arsenate reductase and related

DNA sequence :
GTGAGCGACTCTGATTTCCCGGTGGTGATCTACCACAACCCCAACTGCGGCACGTCGCGTAACGTCCTGGCGATGATCCG
CGCCGCCGGCTACGAGCCTAAGGTCATCGAATACCTGCGGACCGGCTGGACCCACGATCAGCTGCAAGACCTCGCCAAGG
AGGCGGGCCTGTCGTTCCACCAGCTCATGCGCACGCGCGGCACGCCGGCCGAAGAGCTTGGATTGACGGCCGAGGGCGTC
AGCGAGGCGAAGATCCTCGAGGCCATGATCGCTCACCCGATCCTGGTCAACCGTCCGCTGGTGGTCACGCCGCGCGGCGT
CAAGCTCTGCCGGCCGTCGGAGGTGGTGTTCGATCTCCTCGATCGTCACCCCGACAGTTTCACCAAGGAAGATGGCGAGG
TCGTCGACCTGTCGGCGCGGCCCTAA

Protein sequence :
MSDSDFPVVIYHNPNCGTSRNVLAMIRAAGYEPKVIEYLRTGWTHDQLQDLAKEAGLSFHQLMRTRGTPAEELGLTAEGV
SEAKILEAMIAHPILVNRPLVVTPRGVKLCRPSEVVFDLLDRHPDSFTKEDGEVVDLSARP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 9e-28 51
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 7e-24 48
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 1e-23 48
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 1e-23 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cseg_2459 YP_003593532.1 arsenate reductase BAC0583 Protein 3e-30 54
Cseg_2459 YP_003593532.1 arsenate reductase BAC0585 Protein 4e-30 53
Cseg_2459 YP_003593532.1 arsenate reductase BAC0584 Protein 1e-29 51
Cseg_2459 YP_003593532.1 arsenate reductase BAC0582 Protein 3e-29 50