Gene Information

Name : Cseg_2397 (Cseg_2397)
Accession : YP_003593471.1
Strain : Caulobacter segnis ATCC 21756
Genome accession: NC_014100
Putative virulence/resistance : Resistance
Product : arsenate reductase
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG1393
EC number : -
Position : 2626642 - 2627067 bp
Length : 426 bp
Strand : -
Note : KEGG: azc:AZC_4550 arsenate reductase; TIGRFAM: arsenate reductase; PFAM: arsenate reductase and related

DNA sequence :
ATGTGCGCCCCTGATTTCCCGGTGGTGATCTACCACAACCCCAGCTGCGGCACGTCTCGCAACGTCCTCGCCATGATCCG
AGCCGCTGGTTACGAGCCGACGGTCATCGAATACCTGCAGACCGGCTGGACCCACGACCAGTTGCGCGACCTGGCCAGCG
CGGCCGGCCTGACCTTCCGTCAATTGATGCGCACGCGCGGCGCGCCCGCCGAAGAGCTTGGCCTGACGGCCGATGACGTC
AGCGAGGCGGAAATCCTCGACGCGATGGTCGCCCATCCGATCCTGGTCAATCGGCCGCTGGTCGTCACGCAGCGCGGCGT
CAAGCTCTGCCGGCCGTCTGAGGTTGTGTTCGATCTGCTCGATCGCCTCCCATCCAGTTTCACCAAGGAAGACGGCGAGG
TCGTCGATCTGTCGGGCCCGCCCTAG

Protein sequence :
MCAPDFPVVIYHNPSCGTSRNVLAMIRAAGYEPTVIEYLQTGWTHDQLRDLASAAGLTFRQLMRTRGAPAEELGLTADDV
SEAEILDAMVAHPILVNRPLVVTQRGVKLCRPSEVVFDLLDRLPSSFTKEDGEVVDLSGPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
arsC2 YP_001007634.1 arsenate reductase Not tested YAPI Protein 5e-28 53
arsC ADZ05768.1 arsenate reductase Not tested AbaR11 Protein 4e-25 51
arsR CAJ77019.1 arsenate reductase Not tested AbaR1 Protein 4e-25 50
arsC AFC76436.1 ArsC Not tested AbaR5 Protein 6e-25 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cseg_2397 YP_003593471.1 arsenate reductase BAC0583 Protein 3e-30 56
Cseg_2397 YP_003593471.1 arsenate reductase BAC0585 Protein 2e-30 55
Cseg_2397 YP_003593471.1 arsenate reductase BAC0584 Protein 4e-30 53
Cseg_2397 YP_003593471.1 arsenate reductase BAC0582 Protein 1e-29 53