Gene Information

Name : Cseg_1005 (Cseg_1005)
Accession : YP_003592128.1
Strain : Caulobacter segnis ATCC 21756
Genome accession: NC_014100
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1078442 - 1079119 bp
Length : 678 bp
Strand : +
Note : KEGG: ccs:CCNA_02854 two-component response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGCGCATCCTGCTCGTCGAAGACGATCCCGATCTGACGCGCCAGCTGAAGCTGGCCCTGGCCGACGCCGGCTACGCGGT
CGACCACGCGCCCGATGGCGAGGAAGCCCAGTTCCTGGGCGAAACCGAGCCGTATGACGCGGTGATCCTCGATCTTGGCC
TGCCCAAGGTGGACGGCGTCTCGGTGCTGGAGCGCTGGCGGCGGGGCAATATCGCCACGCCGGTCCTGATCCTGACCGCG
CGCGGCGCCTGGAGCGACAAGGTCGCCGGCTTCGACGCGGGCGCCGACGACTATCTGGCCAAGCCCTTCCACACCGAAGA
GCTGCTGGCGCGCCTGCGGGCCCTGCTGCGCCGCTCGGCCGGCCACGCCGCCCCGTCGCTGTCCTGCGGCGCCTTGCGCC
TGGACCCGCGCGCCGCCCGCGCCAGCGTCAATGGCGAGCCGCTGCGCCTGACCTCGCTGGAATACCGCCTGCTGCACTAC
ATGATGATGCACCAGGGGCGGGTGATCGGCCGCACCGAGCTGGTCGAGCACCTGTACGACCAGGACTTCGACCGCGACAG
CAACACCATCGAGGTGTTCATCGGCCGCCTGCGCAAGAAGCTGGGCGCCGAGCGGATCGAGACCGTCCGGGGCCTGGGCT
ATCGCCTCGCGCCGCTGCCGGGCGAAGACGCGGCCTAA

Protein sequence :
MRILLVEDDPDLTRQLKLALADAGYAVDHAPDGEEAQFLGETEPYDAVILDLGLPKVDGVSVLERWRRGNIATPVLILTA
RGAWSDKVAGFDAGADDYLAKPFHTEELLARLRALLRRSAGHAAPSLSCGALRLDPRAARASVNGEPLRLTSLEYRLLHY
MMMHQGRVIGRTELVEHLYDQDFDRDSNTIEVFIGRLRKKLGAERIETVRGLGYRLAPLPGEDAA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 7e-27 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cseg_1005 YP_003592128.1 winged helix family two component transcriptional regulator CP000647.1.gene1136. Protein 9e-36 47
Cseg_1005 YP_003592128.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 1e-35 47
Cseg_1005 YP_003592128.1 winged helix family two component transcriptional regulator BAC0530 Protein 8e-36 47
Cseg_1005 YP_003592128.1 winged helix family two component transcriptional regulator CP004022.1.gene1005. Protein 8e-39 45
Cseg_1005 YP_003592128.1 winged helix family two component transcriptional regulator CP000034.1.gene2022. Protein 1e-35 45
Cseg_1005 YP_003592128.1 winged helix family two component transcriptional regulator NC_002695.1.913289.p Protein 4e-35 45
Cseg_1005 YP_003592128.1 winged helix family two component transcriptional regulator CP001918.1.gene2526. Protein 6e-35 45
Cseg_1005 YP_003592128.1 winged helix family two component transcriptional regulator CP001138.1.gene1939. Protein 6e-36 45
Cseg_1005 YP_003592128.1 winged helix family two component transcriptional regulator BAC0487 Protein 3e-28 45
Cseg_1005 YP_003592128.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-27 42
Cseg_1005 YP_003592128.1 winged helix family two component transcriptional regulator BAC0125 Protein 5e-27 41
Cseg_1005 YP_003592128.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cseg_1005 YP_003592128.1 winged helix family two component transcriptional regulator VFG0473 Protein 1e-29 45
Cseg_1005 YP_003592128.1 winged helix family two component transcriptional regulator VFG0475 Protein 5e-36 45
Cseg_1005 YP_003592128.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-23 41