Gene Information

Name : Btus_0319 (Btus_0319)
Accession : YP_003588236.1
Strain : Kyrpidia tusciae DSM 2912
Genome accession: NC_014098
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : S : Function unknown
COG ID : COG1937
EC number : -
Position : 305333 - 305593 bp
Length : 261 bp
Strand : +
Note : PFAM: protein of unknown function DUF156; KEGG: aac:Aaci_2639 protein of unknown function DUF156

DNA sequence :
ATGGAATACACAGATGCGATGAAGAATCGCCTGAAGCGCATCGAGGGTCAGGTTCGGGGCATTATGGGCATGATGGAAAA
GGAGCAGTCCTGTCGAGATGTTGTCACGCAACTGTCCGCAGTTCGGGCGGCGATCGACCGGCTCATTGTATATGTGATCG
GATCGAACATGGAAATGTGCATCCGGGACGAAGTTGAGAACGGCCGCCCTGCGGACCAAGTGATTCAAGAAGCCATTGAA
CTTTTGATGAAAAGTCGCTGA

Protein sequence :
MEYTDAMKNRLKRIEGQVRGIMGMMEKEQSCRDVVTQLSAVRAAIDRLIVYVIGSNMEMCIRDEVENGRPADQVIQEAIE
LLMKSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SACOL0048 YP_184958.1 hypothetical protein Not tested Type-I SCCmec Protein 1e-15 45
unnamed BAA94324.1 hypothetical protein Not tested Type-I SCCmec Protein 5e-14 44
SAPIG0063 YP_005732873.1 conserved protein YrkD Not tested Type-V SCCmec Protein 1e-15 44
unnamed BAB83476.1 - Not tested SCC 12263 Protein 8e-14 43
unnamed BAC57484.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 5e-16 42
unnamed BAA82210.2 - Not tested Type-II SCCmec Protein 5e-16 42
SAV0048 NP_370572.1 hypothetical protein Not tested Type-II SCCmec Protein 7e-16 42
SA0045 NP_373285.1 hypothetical protein Not tested Type-II SCCmec Protein 7e-16 42
SERP2514 YP_190056.1 hypothetical protein Not tested Type-II SCCmec Protein 7e-16 42
SAR0047 YP_039520.1 hypothetical protein Not tested Type-II SCCmec Protein 8e-16 42
unnamed BAB47614.1 hypothetical protein Not tested Type-III SCCmec Protein 5e-16 42