|
Name : Btus_0319 (Btus_0319) Accession : YP_003588236.1 Strain : Kyrpidia tusciae DSM 2912 Genome accession: NC_014098 Putative virulence/resistance : Unknown Product : hypothetical protein Function : - COG functional category : S : Function unknown COG ID : COG1937 EC number : - Position : 305333 - 305593 bp Length : 261 bp Strand : + Note : PFAM: protein of unknown function DUF156; KEGG: aac:Aaci_2639 protein of unknown function DUF156 DNA sequence : ATGGAATACACAGATGCGATGAAGAATCGCCTGAAGCGCATCGAGGGTCAGGTTCGGGGCATTATGGGCATGATGGAAAA GGAGCAGTCCTGTCGAGATGTTGTCACGCAACTGTCCGCAGTTCGGGCGGCGATCGACCGGCTCATTGTATATGTGATCG GATCGAACATGGAAATGTGCATCCGGGACGAAGTTGAGAACGGCCGCCCTGCGGACCAAGTGATTCAAGAAGCCATTGAA CTTTTGATGAAAAGTCGCTGA Protein sequence : MEYTDAMKNRLKRIEGQVRGIMGMMEKEQSCRDVVTQLSAVRAAIDRLIVYVIGSNMEMCIRDEVENGRPADQVIQEAIE LLMKSR |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| SACOL0048 | YP_184958.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 1e-15 | 45 |
| unnamed | BAA94324.1 | hypothetical protein | Not tested | Type-I SCCmec | Protein | 5e-14 | 44 |
| SAPIG0063 | YP_005732873.1 | conserved protein YrkD | Not tested | Type-V SCCmec | Protein | 1e-15 | 44 |
| unnamed | BAB83476.1 | - | Not tested | SCC 12263 | Protein | 8e-14 | 43 |
| unnamed | BAC57484.1 | hypothetical protein | Not tested | Type-IIIinv SCCmec | Protein | 5e-16 | 42 |
| unnamed | BAA82210.2 | - | Not tested | Type-II SCCmec | Protein | 5e-16 | 42 |
| SAV0048 | NP_370572.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 7e-16 | 42 |
| SA0045 | NP_373285.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 7e-16 | 42 |
| SERP2514 | YP_190056.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 7e-16 | 42 |
| unnamed | BAB47614.1 | hypothetical protein | Not tested | Type-III SCCmec | Protein | 5e-16 | 42 |
| SAR0047 | YP_039520.1 | hypothetical protein | Not tested | Type-II SCCmec | Protein | 8e-16 | 42 |
