Gene Information

Name : Btus_1970 (Btus_1970)
Accession : YP_003589809.1
Strain : Kyrpidia tusciae DSM 2912
Genome accession: NC_014098
Putative virulence/resistance : Resistance
Product : copper ion binding protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1969272 - 1969493 bp
Length : 222 bp
Strand : -
Note : KEGG: sae:NWMN_2458 heavy metal-binding protein; TIGRFAM: copper ion binding protein; PFAM: Heavy metal transport/detoxification protein

DNA sequence : 
TTGGAGACAAAAGTCCTGCATATAAAAGGTATGTCCTGCAGTCATTGTGTACACGCCGTGAAGTCGGCTTTGTCCGCCTT
GGCCGGAGTTCACGAGGTGGATGTGGATCTTGATAAAGGGAAGGCCTCGGTGAAGTTCGACGGATCCAAAGTGGGGGAAA
CTCAATTCCGCAAAGCCATCGAGGAGGCCGGGTACGAATTAACGGGCATGTCGGACCGCTGA

Protein sequence : 
METKVLHIKGMSCSHCVHAVKSALSALAGVHEVDVDLDKGKASVKFDGSKVGETQFRKAIEEAGYELTGMSDR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 3e-08 44
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 4e-08 44
merP AGK07081.1 MerP Not tested SGI1 Protein 3e-08 43
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 5e-08 43
merP ABQ57373.1 MerP Not tested SGI1 Protein 3e-08 43
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 3e-08 43
merP AFG30122.1 MerP Not tested PAGI-2 Protein 3e-08 43
merP AGK07023.1 MerP Not tested SGI1 Protein 3e-08 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Btus_1970 YP_003589809.1 copper ion binding protein BAC0085 Protein 9e-06 46
Btus_1970 YP_003589809.1 copper ion binding protein BAC0634 Protein 1e-07 41
Btus_1970 YP_003589809.1 copper ion binding protein BAC0231 Protein 6e-08 41
Btus_1970 YP_003589809.1 copper ion binding protein BAC0678 Protein 6e-08 41