Gene Information

Name : phoP (BMQ_4766)
Accession : YP_003565202.1
Strain : Bacillus megaterium QM B1551
Genome accession: NC_014019
Putative virulence/resistance : Resistance
Product : two-component response regulator PhoP
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4592084 - 4592800 bp
Length : 717 bp
Strand : -
Note : -

DNA sequence :
ATGAGTAAGAAATTATTAGTCGTAGATGATGAACAATCAATTTCAACATTATTACAATATAATTTACAACAAGCTGGCTT
TACAGTAGAAACAGCTGAAGACGGGGAAGAAGGATACAACAAGGCACTAGAAGGAAAACCGGATTTAATTGTGTTAGACT
TGATGCTTCCTAAGATGGATGGAATTGAAGTTTGTAAAAAGCTTCGTCAGCAAAAAGTGATGACGCCTATTTTAATGTTA
ACTGCAAAAGACGATGAGTTCGACAAAGTATTAGGGCTAGAGCTTGGCGCAGATGACTACATGACGAAACCATTTAGCCC
TCGAGAAGTAGTAGCACGTGTAAAAGCCATTTTACGCAGAACACAAATCATTGCTCAGGAAAATGAACAAGAGGAAGATG
GCGAGCGCATCATGATCGGTGATTTAAAAATTCTTCCAGATCATTATGAGGCCTACTTTAATCAAGAGCAGCTTGAGCTT
ACTCCAAAAGAATTTGAGTTGTTATTATATTTGGCAAAATACAAAGGACGGGTATTAACTCGTGATCAGCTGCTAAGTGC
AGTGTGGAATTATGATTTTGCCGGAGATACGCGAATTGTAGATGTGCACATCAGCCATTTGCGTGAGAAAATTGAACAAA
ATACGCGAAAACCTGTTTATATAAAAACGATTAGAGGATTAGGATATAAGCTGGAGGAACCAAAGGTAGATGAATAA

Protein sequence :
MSKKLLVVDDEQSISTLLQYNLQQAGFTVETAEDGEEGYNKALEGKPDLIVLDLMLPKMDGIEVCKKLRQQKVMTPILML
TAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAILRRTQIIAQENEQEEDGERIMIGDLKILPDHYEAYFNQEQLEL
TPKEFELLLYLAKYKGRVLTRDQLLSAVWNYDFAGDTRIVDVHISHLREKIEQNTRKPVYIKTIRGLGYKLEEPKVDE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-39 42
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 8e-38 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_003565202.1 two-component response regulator PhoP HE999704.1.gene2815. Protein 1e-78 70
phoP YP_003565202.1 two-component response regulator PhoP NC_002952.2859905.p0 Protein 7e-75 66
phoP YP_003565202.1 two-component response regulator PhoP NC_002951.3237708.p0 Protein 8e-75 66
phoP YP_003565202.1 two-component response regulator PhoP NC_003923.1003749.p0 Protein 7e-75 66
phoP YP_003565202.1 two-component response regulator PhoP NC_002758.1121668.p0 Protein 8e-75 66
phoP YP_003565202.1 two-component response regulator PhoP NC_007622.3794472.p0 Protein 5e-75 66
phoP YP_003565202.1 two-component response regulator PhoP NC_009641.5332272.p0 Protein 8e-75 66
phoP YP_003565202.1 two-component response regulator PhoP NC_013450.8614421.p0 Protein 8e-75 66
phoP YP_003565202.1 two-component response regulator PhoP NC_007793.3914279.p0 Protein 8e-75 66
phoP YP_003565202.1 two-component response regulator PhoP NC_002745.1124361.p0 Protein 8e-75 66
phoP YP_003565202.1 two-component response regulator PhoP NC_009782.5559369.p0 Protein 8e-75 66
phoP YP_003565202.1 two-component response regulator PhoP AE016830.1.gene1681. Protein 7e-66 56
phoP YP_003565202.1 two-component response regulator PhoP NC_012469.1.7686381. Protein 3e-60 53
phoP YP_003565202.1 two-component response regulator PhoP NC_012469.1.7685629. Protein 5e-54 53
phoP YP_003565202.1 two-component response regulator PhoP AE000516.2.gene3505. Protein 1e-41 44
phoP YP_003565202.1 two-component response regulator PhoP CP001485.1.gene721.p Protein 7e-36 44
phoP YP_003565202.1 two-component response regulator PhoP CP004022.1.gene3215. Protein 6e-40 44
phoP YP_003565202.1 two-component response regulator PhoP CP001918.1.gene5135. Protein 3e-32 44
phoP YP_003565202.1 two-component response regulator PhoP NC_014475.1.orf0.gen Protein 2e-40 43
phoP YP_003565202.1 two-component response regulator PhoP NC_005054.2598277.p0 Protein 2e-40 43
phoP YP_003565202.1 two-component response regulator PhoP AF162694.1.orf4.gene Protein 2e-36 43
phoP YP_003565202.1 two-component response regulator PhoP AF310956.2.orf0.gene Protein 1e-39 42
phoP YP_003565202.1 two-component response regulator PhoP BAC0197 Protein 7e-32 42
phoP YP_003565202.1 two-component response regulator PhoP BAC0533 Protein 9e-36 42
phoP YP_003565202.1 two-component response regulator PhoP CP000647.1.gene4257. Protein 9e-36 42
phoP YP_003565202.1 two-component response regulator PhoP AE016830.1.gene2255. Protein 3e-38 41
phoP YP_003565202.1 two-component response regulator PhoP U35369.1.gene1.p01 Protein 3e-38 41
phoP YP_003565202.1 two-component response regulator PhoP NC_013450.8614146.p0 Protein 2e-40 41
phoP YP_003565202.1 two-component response regulator PhoP NC_002951.3238224.p0 Protein 2e-40 41
phoP YP_003565202.1 two-component response regulator PhoP NC_007793.3914065.p0 Protein 2e-40 41
phoP YP_003565202.1 two-component response regulator PhoP NC_002758.1121390.p0 Protein 2e-40 41
phoP YP_003565202.1 two-component response regulator PhoP NC_010079.5776364.p0 Protein 2e-40 41
phoP YP_003565202.1 two-component response regulator PhoP NC_002952.2859858.p0 Protein 2e-40 41
phoP YP_003565202.1 two-component response regulator PhoP NC_007622.3794948.p0 Protein 2e-40 41
phoP YP_003565202.1 two-component response regulator PhoP NC_003923.1003417.p0 Protein 2e-40 41
phoP YP_003565202.1 two-component response regulator PhoP BAC0125 Protein 1e-33 41
phoP YP_003565202.1 two-component response regulator PhoP EU250284.1.orf4.gene Protein 6e-39 41
phoP YP_003565202.1 two-component response regulator PhoP AM180355.1.gene1830. Protein 2e-38 41
phoP YP_003565202.1 two-component response regulator PhoP FJ349556.1.orf0.gene Protein 1e-39 41
phoP YP_003565202.1 two-component response regulator PhoP CP004022.1.gene1676. Protein 1e-32 41
phoP YP_003565202.1 two-component response regulator PhoP CP001138.1.gene4273. Protein 6e-36 41
phoP YP_003565202.1 two-component response regulator PhoP NC_002695.1.915041.p Protein 6e-36 41
phoP YP_003565202.1 two-component response regulator PhoP CP000034.1.gene3834. Protein 6e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_003565202.1 two-component response regulator PhoP VFG1389 Protein 1e-34 44
phoP YP_003565202.1 two-component response regulator PhoP VFG1386 Protein 3e-40 42
phoP YP_003565202.1 two-component response regulator PhoP VFG1702 Protein 4e-39 41