Gene Information

Name : BMQ_2699 (BMQ_2699)
Accession : YP_003563155.1
Strain : Bacillus megaterium QM B1551
Genome accession: NC_014019
Putative virulence/resistance : Resistance
Product : Tellurium resistance protein terD,TerD family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2684563 - 2685141 bp
Length : 579 bp
Strand : -
Note : -

DNA sequence : 
ATGGCTATTAATCTTTCAAAAGGACAAAAAGTAGATTTAACAAAAACGAATCCAGGATTAACAAACGTCGTGGTAGGTCT
TGGATGGGACGTAAATAAGTATGACGGTGGAAACGATTTTGATCTAGATTCATCTGTTTTTTTATTAAACGGCGCAGGAA
AATGTGCTTCAGAATCTGATTTTATTTTTTACAATAATACGACGGGTGCAAACGGAGCGGTTGAGCATACCGGAGATAAC
CGTACAGGCGTAGGTGAAGGAGACGATGAGCAGGTTCAAGTAGATTTGAAAAATGTGCCTCAATCTATTGAACGTATCGC
GTTTACCATTACGATTCATGAAGCGGAAGCACGCGGTCAAAACTTCGGTCAAGTAAGCAACGCCTATGTTCGTATTTTAA
ATGCAACAAATGACGAAGAGTTAATTCGTTATGATTTAGGTGAAGACTTCTCTATTGAAACAGCAGTCGTGGTAGGCGAG
CTGTACCGACACGGTGGAGAATGGAAGTTTAATGCTATTGGCAGCGGCTATCAAGGCGGCTTAGCGGCACTTGTAAACGA
CTTCGGTTTAAATGCCTAA

Protein sequence : 
MAINLSKGQKVDLTKTNPGLTNVVVGLGWDVNKYDGGNDFDLDSSVFLLNGAGKCASESDFIFYNNTTGANGAVEHTGDN
RTGVGEGDDEQVQVDLKNVPQSIERIAFTITIHEAEARGQNFGQVSNAYVRILNATNDEELIRYDLGEDFSIETAVVVGE
LYRHGGEWKFNAIGSGYQGGLAALVNDFGLNA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-55 58
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-53 57
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-53 57
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-53 56
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-48 55
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-48 55
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 7e-49 55
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-50 53
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMQ_2699 YP_003563155.1 Tellurium resistance protein terD,TerD family BAC0389 Protein 1e-52 56
BMQ_2699 YP_003563155.1 Tellurium resistance protein terD,TerD family BAC0390 Protein 1e-52 55