Gene Information

Name : BMQ_2698 (BMQ_2698)
Accession : YP_003563154.1
Strain : Bacillus megaterium QM B1551
Genome accession: NC_014019
Putative virulence/resistance : Resistance
Product : tellurium resistance protein, TerD family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 2683949 - 2684527 bp
Length : 579 bp
Strand : -
Note : -

DNA sequence :
ATGTCAATTTCTTTATCAAAAGGTCAGCGCATTGACCTAACCAAAACGAACCCAGGATTAACAAAAGTAATAGTAGGTCT
TGGGTGGGATACAAATAAATATGCTGGATCTCAAGATTTCGATTTAGATGCATGTGCATTTTTAGCCAATAAATCAAGCC
AAGTTGTAAATGACGAGGAGTTTGTTTTTTACAACAATTTAAAAAGTCCAAATGGAGCTGTGGAGCATACCGGTGACAAC
CGTACGGGTGCAGGAGATGGAGACGATGAGCAAATCGCCGTTGATTTTTCTCTTCTTCCTGACCATGTTGAAAAAATCGG
AATTAGCGTCACGATTCACGACGCGGATGCTCGAGGACAAAACTTTGGACAAGTATCCAACGCGTTTGTTCGTTTGATTG
ACGCTGAAACAAATGAAGAAGTGCTTCGATATGACTTAGGCGAAGATTTTTCGATTGAAACAGCTGTCGTTGTATGCGAG
CTATACAAGCACGGAAACGATTGGAAGTTTAATGCTATTGGCAGCGGGTTTTCCGGTGGCTTGGCCGACCTTTGCCGCAA
CTACGGATTATCCGTATAA

Protein sequence :
MSISLSKGQRIDLTKTNPGLTKVIVGLGWDTNKYAGSQDFDLDACAFLANKSSQVVNDEEFVFYNNLKSPNGAVEHTGDN
RTGAGDGDDEQIAVDFSLLPDHVEKIGISVTIHDADARGQNFGQVSNAFVRLIDAETNEEVLRYDLGEDFSIETAVVVCE
LYKHGNDWKFNAIGSGFSGGLADLCRNYGLSV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-54 58
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-51 54
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-51 54
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 5e-51 54
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-46 50
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-46 50
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-46 50
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-46 50
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMQ_2698 YP_003563154.1 tellurium resistance protein, TerD family BAC0389 Protein 8e-52 55
BMQ_2698 YP_003563154.1 tellurium resistance protein, TerD family BAC0390 Protein 4e-50 52