Gene Information

Name : qacE (SVI_1721)
Accession : YP_003556470.1
Strain : Shewanella violacea DSS12
Genome accession: NC_014012
Putative virulence/resistance : Resistance
Product : quaternary ammonium compound-resistance protein QacE
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 1964158 - 1964487 bp
Length : 330 bp
Strand : +
Note : -

DNA sequence : 
ATGGGTTACTGGTATTTGGCTATAGCTATAGGTGCAGAAGTTATCGCAACATTAGCACTTAAAGCATCAGATGGTTTTTC
TCATTCAACCTCTAGTACGGTTTGTGTTATTGGGTATGCAGTTGCATTTTACTTCTTATCCTTGGTATTAAAAACTGTGC
CTGTGGGTATCGCTTATGCCATTTGGGCAGGCATGGGAATAGTCTTAATAGCATCAATCAGTGCTGTAATTTACAAACAA
ATACCAGATGCTCCCGCCATAATCGGTATGGTATTAATATTAGCGGGTGTCCTTGTTATTAATGTATTTTCAAAGACGGT
GAGCCATTGA

Protein sequence : 
MGYWYLAIAIGAEVIATLALKASDGFSHSTSSTVCVIGYAVAFYFLSLVLKTVPVGIAYAIWAGMGIVLIASISAVIYKQ
IPDAPAIIGMVLILAGVLVINVFSKTVSH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 3e-20 53
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 3e-20 53
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-20 53
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 5e-20 53
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 3e-20 53
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 3e-20 53
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-20 53
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 3e-20 53
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 3e-20 53
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-20 53
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 3e-20 53
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 3e-20 53
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 3e-20 53
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 3e-20 53
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 3e-20 53
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 3e-20 53
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 3e-20 53
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 5e-20 53
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 3e-20 53
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 3e-20 53
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 3e-20 53
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 5e-20 53
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 3e-20 53
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 3e-20 53
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-20 53
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 5e-20 53
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 3e-20 53
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 3e-20 53
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 3e-20 53
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 5e-20 53
unnamed CAD42067.1 hypothetical protein Not tested PAI II 536 Protein 1e-15 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
qacE YP_003556470.1 quaternary ammonium compound-resistance protein QacE NC_010410.6003348.p0 Protein 2e-24 62
qacE YP_003556470.1 quaternary ammonium compound-resistance protein QacE BAC0002 Protein 2e-24 62
qacE YP_003556470.1 quaternary ammonium compound-resistance protein QacE BAC0377 Protein 6e-22 58
qacE YP_003556470.1 quaternary ammonium compound-resistance protein QacE CP004022.1.gene1549. Protein 6e-20 58
qacE YP_003556470.1 quaternary ammonium compound-resistance protein QacE BAC0324 Protein 3e-21 56
qacE YP_003556470.1 quaternary ammonium compound-resistance protein QacE CP001138.1.gene1489. Protein 6e-20 56
qacE YP_003556470.1 quaternary ammonium compound-resistance protein QacE BAC0322 Protein 2e-23 54
qacE YP_003556470.1 quaternary ammonium compound-resistance protein QacE BAC0323 Protein 1e-20 53
qacE YP_003556470.1 quaternary ammonium compound-resistance protein QacE NC_002695.1.913273.p Protein 1e-15 50
qacE YP_003556470.1 quaternary ammonium compound-resistance protein QacE BAC0150 Protein 1e-15 50
qacE YP_003556470.1 quaternary ammonium compound-resistance protein QacE BAC0192 Protein 6e-17 46
qacE YP_003556470.1 quaternary ammonium compound-resistance protein QacE BAC0139 Protein 4e-16 43
qacE YP_003556470.1 quaternary ammonium compound-resistance protein QacE BAC0327 Protein 5e-13 43
qacE YP_003556470.1 quaternary ammonium compound-resistance protein QacE BAC0321 Protein 4e-18 42
qacE YP_003556470.1 quaternary ammonium compound-resistance protein QacE BAC0329 Protein 2e-14 42
qacE YP_003556470.1 quaternary ammonium compound-resistance protein QacE BAC0325 Protein 4e-14 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
qacE YP_003556470.1 quaternary ammonium compound-resistance protein QacE VFG1586 Protein 6e-16 42