Gene Information

Name : cusR (SJA_C1-07170)
Accession : YP_003544163.1
Strain :
Genome accession: NC_014006
Putative virulence/resistance : Virulence
Product : two-component system response regulator CusR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 731999 - 732685 bp
Length : 687 bp
Strand : -
Note : two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR / response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence : 
ATGAGCCACAAGATCTTGGTGGTGGAGGACGATGCGGCGACCGCCGCCTATGTCGCCAAGGGCATGGGCGAGGCGGGCTT
CACCGTCGACCGGGCGGACAATGGCCGCGACGGCCTGTTCCTGGCGAGCGACGGCAGCTATGGCGCGATCATCCTGGACC
GGATGATGCCGGCGATGGACGGCATGGCGATGCTGAAGGCCCTGCGCGCGGCGGAGATCGAAACGCCGGTCATCATCCTT
TCCGCGCTGGGCACGCCGGAGGACCGTGTGGAGGGGCTGACCAGCGGCGCGGACGATTATCTGGCCAAGCCCTTCGCCTT
CGCCGAGCTGATGGCCCGCGTCCAGTTGCTGCTGCGCCGGGGCGGGGGCGGCGGCGGGGTCGTCACCCATTTGCGGCACG
CGGACCTGGAGATGGACCTGCTTTCCCGCCGGGTGAAGCGGGGATCACGCTCCGTCGACCTGCAACCGCGCGAGTTCCGC
CTGCTGGAATATTTCCTGCGCCATCCAGACCAGGTGGTGACGCGAACCATGCTGCTGGAAGGCGTCTGGGACTATCATTT
CGATCCCGGCACCAACGTCATCGACGTGCATGTCAGCCGCCTGCGCCGCAAGCTGGACGATGGCGGCGACAGGCCCCTGC
TGCATACCGTGCGCGGCATGGGCTATCGGCTGGGGCCGGAGAGTTAG

Protein sequence : 
MSHKILVVEDDAATAAYVAKGMGEAGFTVDRADNGRDGLFLASDGSYGAIILDRMMPAMDGMAMLKALRAAEIETPVIIL
SALGTPEDRVEGLTSGADDYLAKPFAFAELMARVQLLLRRGGGGGGVVTHLRHADLEMDLLSRRVKRGSRSVDLQPREFR
LLEYFLRHPDQVVTRTMLLEGVWDYHFDPGTNVIDVHVSRLRRKLDDGGDRPLLHTVRGMGYRLGPES

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-35 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-34 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_003544163.1 two-component system response regulator CusR BAC0125 Protein 5e-42 50
cusR YP_003544163.1 two-component system response regulator CusR BAC0111 Protein 5e-42 49
cusR YP_003544163.1 two-component system response regulator CusR BAC0347 Protein 7e-39 48
cusR YP_003544163.1 two-component system response regulator CusR BAC0638 Protein 3e-33 47
cusR YP_003544163.1 two-component system response regulator CusR BAC0308 Protein 5e-33 46
cusR YP_003544163.1 two-component system response regulator CusR BAC0197 Protein 1e-32 46
cusR YP_003544163.1 two-component system response regulator CusR BAC0083 Protein 5e-38 45

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
cusR YP_003544163.1 two-component system response regulator CusR VFG0596 Protein 2e-35 46
cusR YP_003544163.1 two-component system response regulator CusR VFG1389 Protein 3e-28 46