Name : Mmah_1005 (Mmah_1005) Accession : YP_003542168.1 Strain : Methanohalophilus mahii DSM 5219 Genome accession: NC_014002 Putative virulence/resistance : Resistance Product : Heavy metal transport/detoxification protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 1031987 - 1032187 bp Length : 201 bp Strand : + Note : InterPro IPR000428:IPR001802:IPR006121:IPR017969; KEGG: abu:Abu_0480 heavy-metal transporting P-type ATPase; PFAM: Heavy metal transport/detoxification protein; SPTR: Q12Y92 Heavy metal transport/detoxification protein; PFAM: Heavy-metal-associated domain DNA sequence : ATGGAAAAGATAGATATTAAAGTTAAAGGAATGGCATGCGGCCACTGTAAGATGGCAGTTGAGAAGGCATTACAAAAGAT TACGTCTGTATCCAAAGCTGAAGTAGATCTTGAAAAATGTGAAGTCCACGTGGAATATGAACCTGATATAAGTGTAGAGG ATCTGAAAAAAGCTGTCAGGGATGCAGGTTACGAGGCATAA Protein sequence : MEKIDIKVKGMACGHCKMAVEKALQKITSVSKAEVDLEKCEVHVEYEPDISVEDLKKAVRDAGYEA |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 4e-08 | 44 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 2e-08 | 41 |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 2e-08 | 41 |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 2e-08 | 41 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 2e-08 | 41 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 3e-08 | 41 |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 2e-08 | 41 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
Mmah_1005 | YP_003542168.1 | Heavy metal transport/detoxification protein | BAC0634 | Protein | 2e-08 | 48 |