Gene Information

Name : Mmah_1005 (Mmah_1005)
Accession : YP_003542168.1
Strain : Methanohalophilus mahii DSM 5219
Genome accession: NC_014002
Putative virulence/resistance : Resistance
Product : Heavy metal transport/detoxification protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1031987 - 1032187 bp
Length : 201 bp
Strand : +
Note : InterPro IPR000428:IPR001802:IPR006121:IPR017969; KEGG: abu:Abu_0480 heavy-metal transporting P-type ATPase; PFAM: Heavy metal transport/detoxification protein; SPTR: Q12Y92 Heavy metal transport/detoxification protein; PFAM: Heavy-metal-associated domain

DNA sequence :
ATGGAAAAGATAGATATTAAAGTTAAAGGAATGGCATGCGGCCACTGTAAGATGGCAGTTGAGAAGGCATTACAAAAGAT
TACGTCTGTATCCAAAGCTGAAGTAGATCTTGAAAAATGTGAAGTCCACGTGGAATATGAACCTGATATAAGTGTAGAGG
ATCTGAAAAAAGCTGTCAGGGATGCAGGTTACGAGGCATAA

Protein sequence :
MEKIDIKVKGMACGHCKMAVEKALQKITSVSKAEVDLEKCEVHVEYEPDISVEDLKKAVRDAGYEA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 4e-08 44
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-08 41
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 3e-08 41
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-08 41
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-08 41
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-08 41
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-08 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mmah_1005 YP_003542168.1 Heavy metal transport/detoxification protein BAC0634 Protein 2e-08 48