Gene Information

Name : EAM_3026 (EAM_3026)
Accession : YP_003540091.1
Strain : Erwinia amylovora ATCC 49946
Genome accession: NC_013971
Putative virulence/resistance : Virulence
Product : phage-regulatory protein
Function : -
COG functional category : K : Transcription
COG ID : COG3311
EC number : -
Position : 3307405 - 3307602 bp
Length : 198 bp
Strand : +
Note : -

DNA sequence : 
ATGACGATCAAACCTTCCCTGCTCGAAGATCAATTTATTGACATGGCATTTATCACCAACCTGCTTCAAATGACAGATAA
ATGGCTGTATAAGCTCATCAAAGACGGTATATTCCCGCAACCAATCAAACTGGGGCGCAGCTCTCGCTGGCTTGAAAGCG
AAGTTGAAGCCTGGCTTCAGGAACGTATTAACCAGTAA

Protein sequence : 
MTIKPSLLEDQFIDMAFITNLLQMTDKWLYKLIKDGIFPQPIKLGRSSRWLESEVEAWLQERINQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAE85187.1 hypothetical protein Not tested PAI V 536 Protein 7e-19 74
unnamed ADD91712.1 putative transcriptional regulator AlpA Not tested PAI-I AL862 Protein 6e-18 71
unnamed CAI43835.1 hypothetical protein Not tested LEE Protein 6e-18 71
rox AAR97599.1 regulator of excision Not tested SHI-1 Protein 2e-18 70
S3190 NP_838473.1 hypothetical protein Not tested SHI-1 Protein 4e-18 70
SF2987 NP_708761.1 hypothetical protein Not tested SHI-1 Protein 4e-18 70
ECO103_3577 YP_003223438.1 transcriptional regulator Not tested LEE Protein 3e-18 70
unnamed AAL08466.1 unknown Not tested SRL Protein 2e-18 70
Z1188 NP_286723.1 hypothetical protein Not tested TAI Protein 2e-12 64
Z1627 NP_287131.1 hypothetical protein Not tested TAI Protein 2e-12 64
c5192 NP_757040.1 hypothetical protein Not tested PAI II CFT073 Protein 5e-15 64
unnamed CAD33739.1 hypothetical protein Not tested PAI I 536 Protein 3e-15 64

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EAM_3026 YP_003540091.1 phage-regulatory protein VFG0651 Protein 1e-18 70
EAM_3026 YP_003540091.1 phage-regulatory protein VFG1057 Protein 9e-19 70
EAM_3026 YP_003540091.1 phage-regulatory protein VFG1480 Protein 1e-15 64