Name : EAMY_0394 (EAMY_0394) Accession : YP_003529752.1 Strain : Erwinia amylovora CFBP1430 Genome accession: NC_013961 Putative virulence/resistance : Virulence Product : hypothetical protein Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 463698 - 463895 bp Length : 198 bp Strand : - Note : Uncharacterized protein ORF88 ( DNA-binding protein), DNA binding, Prophage CP4-57 regulatory protein (AlpA) DNA sequence : ATGACGATCAAACCTTCCCTGCTCGAAGATCAATTTATTGACATGGCATTTATCACCAACCTGCTTCAAATGACAGATAA ATGGCTGTATAAGCTCATCAAAGACGGTATATTCCCGCAACCAATCAAACTGGGGCGCAGCTCTCGCTGGCTTGAAAGCG AAGTTGAAGCCTGGCTTCAGGAACGTATTAACCAGTAA Protein sequence : MTIKPSLLEDQFIDMAFITNLLQMTDKWLYKLIKDGIFPQPIKLGRSSRWLESEVEAWLQERINQ |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 7e-19 | 74 |
unnamed | CAI43835.1 | hypothetical protein | Not tested | LEE | Protein | 6e-18 | 71 |
unnamed | ADD91712.1 | putative transcriptional regulator AlpA | Not tested | PAI-I AL862 | Protein | 6e-18 | 71 |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 3e-18 | 70 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 2e-18 | 70 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 4e-18 | 70 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 4e-18 | 70 |
unnamed | AAL08466.1 | unknown | Not tested | SRL | Protein | 2e-18 | 70 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 2e-12 | 64 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 2e-12 | 64 |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 3e-15 | 64 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 5e-15 | 64 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
EAMY_0394 | YP_003529752.1 | hypothetical protein | VFG0651 | Protein | 1e-18 | 70 |
EAMY_0394 | YP_003529752.1 | hypothetical protein | VFG1057 | Protein | 9e-19 | 70 |
EAMY_0394 | YP_003529752.1 | hypothetical protein | VFG1480 | Protein | 1e-15 | 64 |