Gene Information

Name : soxS3 (EAMY_3560)
Accession : YP_003532913.1
Strain : Erwinia amylovora CFBP1430
Genome accession: NC_013961
Putative virulence/resistance : Resistance
Product : regulatory protein pqrA
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 3648470 - 3648802 bp
Length : 333 bp
Strand : -
Note : Helix-turn-helix, AraC type

DNA sequence : 
ATGAAAAACGACATTGTCGATGTCATCGTAGACTGGATCGAATGCCATATTGAAGAAGGGCCTGATATTGAAGCGGTTGC
GGCGAAATCGGGCTATTCGAAATGGCATCTGCAACGCGCCTTTAAAGCGCAGAAGGGCATCACTCTGGCGACCTTTATTC
GCGGCCGCCGCCTTGAACAGGCCGCGCAATGCCTGGTGAGTTCGAGCAAAACGATTATGGCTATCTCCATGGATCTCGGC
TTCTCTTCCCAGCAGTGTTTCCAGCGGGTGTTCAAAAAACATTTCCACATTACCCCGCGCGATTACCGCATCCGGCACCG
CCAGTTTCACTGA

Protein sequence : 
MKNDIVDVIVDWIECHIEEGPDIEAVAAKSGYSKWHLQRAFKAQKGITLATFIRGRRLEQAAQCLVSSSKTIMAISMDLG
FSSQQCFQRVFKKHFHITPRDYRIRHRQFH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 1e-22 48
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 5e-19 43
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 5e-19 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS3 YP_003532913.1 regulatory protein pqrA CP001918.1.gene327.p Protein 3e-24 50
soxS3 YP_003532913.1 regulatory protein pqrA CP000647.1.gene4499. Protein 4e-24 49
soxS3 YP_003532913.1 regulatory protein pqrA BAC0371 Protein 1e-22 48
soxS3 YP_003532913.1 regulatory protein pqrA NC_002695.1.914293.p Protein 1e-22 48
soxS3 YP_003532913.1 regulatory protein pqrA CP001138.1.gene4488. Protein 3e-23 48
soxS3 YP_003532913.1 regulatory protein pqrA CP000034.1.gene4505. Protein 2e-22 48
soxS3 YP_003532913.1 regulatory protein pqrA CP001918.1.gene2033. Protein 3e-20 44
soxS3 YP_003532913.1 regulatory protein pqrA CP000647.1.gene1624. Protein 3e-20 43
soxS3 YP_003532913.1 regulatory protein pqrA NC_010558.1.6276025. Protein 2e-19 43
soxS3 YP_003532913.1 regulatory protein pqrA BAC0560 Protein 2e-20 42
soxS3 YP_003532913.1 regulatory protein pqrA CP001138.1.gene1637. Protein 2e-20 42
soxS3 YP_003532913.1 regulatory protein pqrA NC_002695.1.917339.p Protein 2e-20 42
soxS3 YP_003532913.1 regulatory protein pqrA CP000034.1.gene1596. Protein 2e-20 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
soxS3 YP_003532913.1 regulatory protein pqrA VFG0585 Protein 3e-23 48
soxS3 YP_003532913.1 regulatory protein pqrA VFG1038 Protein 2e-19 43