Gene Information

Name : Nhal_2993 (Nhal_2993)
Accession : YP_003528440.1
Strain : Nitrosococcus halophilus Nc 4
Genome accession: NC_013960
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 3071071 - 3071649 bp
Length : 579 bp
Strand : +
Note : PFAM: stress protein; KEGG: noc:Noc_1008 stress protein

DNA sequence :
ATGCCAGTTAAGCTAGTCAAAGGCCAGAAAATCTCTCTTGAAAAAGAAAGTGGTGGGGCCTTAAGTCAGGTGGTGATGGG
GTTGGGTTGGGATGCCGCAGGGAAAAAGGGATTTTTTGGTTTTGGTGGCGGTCAGCAAATTGATTTAGACGCCTCTTGCG
TGCTTTTTGACGAGGCAGGCAATGTCGTTGATACGGTCTGGTTCCGGCAGTTGCAAAGTAAAGATGGAAGCATCACCCAT
ACGGGAGATAATCTTACCGGGGAAGGGGAAGGCGATGATGAACAAATCATTGTAGACTTGACTCGCGTACCCGCAAATGT
CAAAAGTTTGATGTTTGTTGTCAATAGCTTTACCGGCCAAAACTTTAGCCAGGTTCAAAATGCCTTTTGCCGCCTGGTTA
ATCGCAGCAACAATGCTGAAATCGCCCGTTACGATTTAAGCTGCCAGGGTGATCACAGCGCCCAAATCATGGCCAAAGTC
TACCGTCATAATAATGAGTGGAAGATGCACGCTATTGGTGAAAATGCAAGCGGAAGGACTTTCAATGATCTGCTTCCTGC
TATGCGCCCCCATGTGTAA

Protein sequence :
MPVKLVKGQKISLEKESGGALSQVVMGLGWDAAGKKGFFGFGGGQQIDLDASCVLFDEAGNVVDTVWFRQLQSKDGSITH
TGDNLTGEGEGDDEQIIVDLTRVPANVKSLMFVVNSFTGQNFSQVQNAFCRLVNRSNNAEIARYDLSCQGDHSAQIMAKV
YRHNNEWKMHAIGENASGRTFNDLLPAMRPHV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 6e-46 54
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-39 50
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-39 50
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 6e-30 45
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-28 43
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-28 43
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 4e-27 42
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-27 42
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-27 42
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-26 42
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-28 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nhal_2993 YP_003528440.1 stress protein BAC0392 Protein 2e-39 50
Nhal_2993 YP_003528440.1 stress protein BAC0390 Protein 4e-28 44
Nhal_2993 YP_003528440.1 stress protein BAC0389 Protein 2e-28 43