Gene Information

Name : Nhal_1678 (Nhal_1678)
Accession : YP_003527193.1
Strain : Nitrosococcus halophilus Nc 4
Genome accession: NC_013960
Putative virulence/resistance : Resistance
Product : mercuric transporter periplasmic component
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1708341 - 1708640 bp
Length : 300 bp
Strand : -
Note : TIGRFAM: mercuric transporter periplasmic component; PFAM: Heavy metal transport/detoxification protein; KEGG: amc:MADE_01410 periplasmic mercuric ion binding protein MerP

DNA sequence :
ATGAAACACGGGGTTATTGTGCTGGTTTTTATGGTCGGTTTGCTGAGTACTGCCGGGGCCTGGGCGGGTGAAAAGACCGT
CACCCTTGAGGTAGAGAACATGACCTGCGCCCTCTGCCCGGTCACGGTTCGCAAGGCCCTAGAAGCCCTAGACGGGGTGC
AGAAGGTGGAAATCTCCCTTGCTAATAAAACCGCGAGGGTGACATTCGAGGACGAAAAGACGACTCTTTCCGCCCTGACG
GCGGCAACCACCCATGCAGGCTATCCGTCTCGTCTTTCCCGGGAGAAAGCCCATGAATAA

Protein sequence :
MKHGVIVLVFMVGLLSTAGAWAGEKTVTLEVENMTCALCPVTVRKALEALDGVQKVEISLANKTARVTFEDEKTTLSALT
AATTHAGYPSRLSREKAHE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 1e-10 53
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 8e-11 53
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 8e-11 53
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 9e-12 50
merP AGK07081.1 MerP Not tested SGI1 Protein 7e-11 50
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 1e-10 50
merP ABQ57373.1 MerP Not tested SGI1 Protein 7e-11 50
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 7e-11 50
merP AFG30122.1 MerP Not tested PAGI-2 Protein 7e-11 50
merP AGK07023.1 MerP Not tested SGI1 Protein 7e-11 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Nhal_1678 YP_003527193.1 mercuric transporter periplasmic component BAC0675 Protein 2e-11 55
Nhal_1678 YP_003527193.1 mercuric transporter periplasmic component BAC0674 Protein 3e-11 52
Nhal_1678 YP_003527193.1 mercuric transporter periplasmic component BAC0679 Protein 2e-11 52
Nhal_1678 YP_003527193.1 mercuric transporter periplasmic component BAC0678 Protein 6e-11 49
Nhal_1678 YP_003527193.1 mercuric transporter periplasmic component BAC0231 Protein 7e-11 49