|
Name : Slit_0587 (Slit_0587) Accession : YP_003523214.1 Strain : Sideroxydans lithotrophicus ES-1 Genome accession: NC_013959 Putative virulence/resistance : Virulence Product : flagellar biosynthetic protein FliQ Function : - COG functional category : N : Cell motility COG ID : COG1987 EC number : - Position : 599478 - 599747 bp Length : 270 bp Strand : - Note : KEGG: mei:Msip34_0767 flagellar biosynthetic protein FliQ; TIGRFAM: flagellar biosynthetic protein FliQ; PFAM: export protein FliQ family 3 DNA sequence : GTGACCCCCGAATCGGTAATGACCATAGGTCAGCAGGCACTTGAGTTGACGATCATGGTGTCTGCGCCCCCGCTGCTCAC CGCGCTCATCATCGGCTTGCTCGTCAGCATCTTCCAGGCCGCGACACAGATCAACGAGCTCACGCTGTCGTTCATCCCCA AGCTGCTCGGCGCGTTCGTCGTCCTCATCATCTCCGGCCCGTGGATGATCGGCATACTCCTGGATTACATAACGCGTCTG TTCAGCAGCATCCCCTACCTGGTCGGGTGA Protein sequence : MTPESVMTIGQQALELTIMVSAPPLLTALIIGLLVSIFQAATQINELTLSFIPKLLGAFVVLIISGPWMIGILLDYITRL FSSIPYLVG |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| hrcS | AAB06006.1 | HrcS | Virulence | Hrp PAI | Protein | 1e-08 | 43 |
| spaQ | NP_806492.1 | virulence-associated secretory protein | Virulence | SPI-1 | Protein | 7e-07 | 42 |
| spaQ | NP_461810.1 | needle complex export protein | Virulence | SPI-1 | Protein | 7e-07 | 42 |
| spaQ | YP_217808.1 | surface presentation of antigens; secretory proteins | Virulence | SPI-1 | Protein | 7e-07 | 42 |
| spaQ | NP_457283.1 | secretory protein (associated with virulence) | Virulence | SPI-1 | Protein | 7e-07 | 42 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Slit_0587 | YP_003523214.1 | flagellar biosynthetic protein FliQ | VFG2339 | Protein | 4e-18 | 58 |
| Slit_0587 | YP_003523214.1 | flagellar biosynthetic protein FliQ | VFG2495 | Protein | 2e-11 | 58 |
| Slit_0587 | YP_003523214.1 | flagellar biosynthetic protein FliQ | VFG2015 | Protein | 3e-16 | 51 |
| Slit_0587 | YP_003523214.1 | flagellar biosynthetic protein FliQ | VFG1260 | Protein | 3e-14 | 45 |
| Slit_0587 | YP_003523214.1 | flagellar biosynthetic protein FliQ | VFG0550 | Protein | 2e-07 | 42 |
| Slit_0587 | YP_003523214.1 | flagellar biosynthetic protein FliQ | VFG2132 | Protein | 2e-10 | 42 |
| Slit_0587 | YP_003523214.1 | flagellar biosynthetic protein FliQ | VFG0187 | Protein | 0.003 | 41 |
