Gene Information

Name : Snas_4842 (Snas_4842)
Accession : YP_003513576.1
Strain : Stackebrandtia nassauensis DSM 44728
Genome accession: NC_013947
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5140977 - 5141654 bp
Length : 678 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: pca:Pcar_3081 two component signal transduction response regulator

DNA sequence : 
ATGCGGCTCCTGATTGTCGAAGACGAACAGCGGATGGCCAACGCGCTGGCGCGCGGCCTCAAGGCGGACGGTTTCGCCGT
CGAGGTCGCCGCCGACGGCGAGGCCGGGCTGGAGGCGGCCCGGTTCGGCAGCTACGACGCCATCATCTTGGACATCATGC
TGCCCAAACTGTCGGGCTACGAGGTGATCCGCACGCTGCGGCGCGAGAACAACTGGGTGCCGGTGCTGGTGCTGTCGGCC
AAGGACGGCGAGTACGACCAGTCGGACGGGCTCGACCTGGGCGCCGACGACTACCTGACCAAGCCGTTCTCGTACGTGGT
GTTGTTGGCCCGGTTGCGGGCGCTGCTGCGGCGCGGCACCCCGGCGCGGCCCTCGGTGCTGACCGTCGGCGACCTGACGC
TGGACCCGGCGCGGCACACCGTCCACCGCGAGGACACCGAGATCTCACTGTCCACACGCGAGTTCTCGTTGCTGGAATAC
CTGATGCGCAACGCCGAACAGGTCGTCACGAAGGTGACGCTGTTGGACCATGTCTGGTCGGCCAGTGAGGACACCCACGT
CAACCTCGTCGAGGTCTACATCGGATATCTGCGCAAAAAGATCGACACCCCGTTCGGACGCAGCAGCCTGCAGACGGTCC
GGGGGGCGGGCTACCGGCTGACGGCGGACCGCCGATGA

Protein sequence : 
MRLLIVEDEQRMANALARGLKADGFAVEVAADGEAGLEAARFGSYDAIILDIMLPKLSGYEVIRTLRRENNWVPVLVLSA
KDGEYDQSDGLDLGADDYLTKPFSYVVLLARLRALLRRGTPARPSVLTVGDLTLDPARHTVHREDTEISLSTREFSLLEY
LMRNAEQVVTKVTLLDHVWSASEDTHVNLVEVYIGYLRKKIDTPFGRSSLQTVRGAGYRLTADRR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-34 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-33 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Snas_4842 YP_003513576.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-38 45
Snas_4842 YP_003513576.1 winged helix family two component transcriptional regulator BAC0083 Protein 9e-36 45
Snas_4842 YP_003513576.1 winged helix family two component transcriptional regulator BAC0111 Protein 1e-36 44
Snas_4842 YP_003513576.1 winged helix family two component transcriptional regulator BAC0308 Protein 6e-35 44
Snas_4842 YP_003513576.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-35 43
Snas_4842 YP_003513576.1 winged helix family two component transcriptional regulator BAC0347 Protein 3e-31 42
Snas_4842 YP_003513576.1 winged helix family two component transcriptional regulator BAC0638 Protein 4e-27 42
Snas_4842 YP_003513576.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Snas_4842 YP_003513576.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-34 43
Snas_4842 YP_003513576.1 winged helix family two component transcriptional regulator VFG1386 Protein 8e-34 42