Gene Information

Name : Snas_3904 (Snas_3904)
Accession : YP_003512652.1
Strain : Stackebrandtia nassauensis DSM 44728
Genome accession: NC_013947
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4172453 - 4173145 bp
Length : 693 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: afw:Anae109_0880 two component transcriptional regulator

DNA sequence :
ATGGCGACACCCCAGCCCAGCCGTGGCCTGGTGCTGATCGCCGAGGACGACGCGGCCATCGCCGACCTGGTGAGCATGTA
CCTGCGGCGCGACGGTTTCGGTGTCCGGGTCGAGACCGACGGGGTCGGGGCGCTGACGGCGATCCGCAGCGTGCGGCCGG
TCGCGGTGGCGCTCGACATCGGACTGCCCGGCAAGGACGGCATCGAGCTGTGCACCGAGCTGCGCGCCGCCGGGGACTGG
ACACCGGTGCTGTTCATGACCGCCCGCGACGACGAGGTGGACCGGTTGCTGGGCTTGGAGATCGGCGCCGACGACTACAT
CACGAAGCCGTTCTCGCCGCGCGAGCTGACCGCGCGGGTTCGCACGGTGCTGCGCCGCGCGTCGGGCGGCTCGGCCGCCA
CCGAGGCGCTCACCGTCGGCGCGGTCCGGCTCGACCCCGCCCGCCGCCGGGTCTGGGCCGCCGACGCCGAGGTCGAGCTC
ACCGTCACCGAGTTCGACCTGCTGGCCAGCTTGATGCGCAACCCCGGGCAGGTCTTCGCCCGCGAACAGCTGCTGTCCGC
CGTGTGGGGGTACACCGCCTCGGCGGGCACCCGCACCGTCGACGTCCACATCGCGCAGCTGCGCGGCAAACTCGGCGACC
ACAGCCCGATCAGGACGGTCCGCGGCGTCGGCTACGCGGCGGACGCGTCATGA

Protein sequence :
MATPQPSRGLVLIAEDDAAIADLVSMYLRRDGFGVRVETDGVGALTAIRSVRPVAVALDIGLPGKDGIELCTELRAAGDW
TPVLFMTARDDEVDRLLGLEIGADDYITKPFSPRELTARVRTVLRRASGGSAATEALTVGAVRLDPARRRVWAADAEVEL
TVTEFDLLASLMRNPGQVFAREQLLSAVWGYTASAGTRTVDVHIAQLRGKLGDHSPIRTVRGVGYAADAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 2e-24 42
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 9e-22 42
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 1e-22 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 1e-22 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 1e-22 41
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 1e-22 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-37 45
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-43 44
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-43 44
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-43 44
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-43 44
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-43 44
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-43 44
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-39 44
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-43 44
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-43 44
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 5e-34 44
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-43 43
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-43 43
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 1e-34 43
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 8e-35 43
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator BAC0039 Protein 1e-34 43
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator BAC0596 Protein 8e-35 43
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 1e-34 43
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 8e-35 43
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-26 42
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 5e-39 42
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-31 41
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-31 41
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-31 41
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-31 41
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-31 41
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-31 41
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-31 41
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-31 41
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-28 41
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator BAC0533 Protein 4e-27 41
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 1e-29 41
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 4e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator VFG1389 Protein 7e-34 46
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator VFG0473 Protein 2e-28 43
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator VFG1390 Protein 6e-34 42
Snas_3904 YP_003512652.1 winged helix family two component transcriptional regulator VFG1386 Protein 4e-32 41