Gene Information

Name : Snas_1849 (Snas_1849)
Accession : YP_003510638.1
Strain : Stackebrandtia nassauensis DSM 44728
Genome accession: NC_013947
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1938100 - 1938789 bp
Length : 690 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sat:SYN_00981 response regulator

DNA sequence :
ATGAGAGCAAGGGTCTTGGTCGTCGACGACGACCCCGCGCTGGCGGAGATGCTGGGGATAGTCCTGCGCACCGAGGGGTT
CACCCCGGTGTTCGTCACCGACGGGGAACAGGCGCTCGAGGCGTTCCACGAACACCGTCCGGACGTGGTGTTGCTGGACC
TGATGCTGCCGGGCATGAGCGGCATCGACGTGTGCAAGCAGATCCGGCTGGAGTCGGGCGTGCCGATCGTGATGCTGACC
GCCAAGTCCGACACCGTCGACGTGGTGCTCGGCCTGGAGTCGGGTGCCGACGACTACGTGATCAAGCCGTTCAAGCCCAA
GGAACTGGTGGCCCGGGTGCGGGCCCGGCTGCGGCGCGGTGACGACGTCGCCCCCGAGCGGCTCCAGATCGGACGGCCCG
GCCTGCAGGTGTCCATCGACGTCCCCGCGCACTCGGCGACCCTCAACGGCGTCGAGGTGAAACTGACGCCGCTGGAGTTC
GACCTGCTGGTGGCGCTGGCCCGCAAACCCCGGCAGGTGTTCACCCGCGAGGTGCTGCTGGAACAGGTGTGGGGTTACCG
GCACGCGGCCGACACCCGGCTGGTCAACGTCCACGTGCAGCGGCTGCGCGCCAAGATCGAACCCGATCCGGAGAACCCGC
AGCTCATCCAGACCGTGCGCGGGGTCGGTTATAAGGCGGGGACGGCCTGA

Protein sequence :
MRARVLVVDDDPALAEMLGIVLRTEGFTPVFVTDGEQALEAFHEHRPDVVLLDLMLPGMSGIDVCKQIRLESGVPIVMLT
AKSDTVDVVLGLESGADDYVIKPFKPKELVARVRARLRRGDDVAPERLQIGRPGLQVSIDVPAHSATLNGVEVKLTPLEF
DLLVALARKPRQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRAKIEPDPENPQLIQTVRGVGYKAGTA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-35 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-74 76
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-40 47
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 4e-40 47
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-40 47
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-40 47
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-40 47
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-40 47
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-40 47
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-40 47
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-40 47
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-40 47
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 6e-38 47
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-29 43
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-36 43
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 8e-35 42
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 8e-35 42
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 8e-35 42
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 8e-35 42
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 8e-35 42
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 8e-35 42
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 8e-35 42
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 8e-35 42
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 3e-37 42
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator BAC0596 Protein 4e-35 42
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 1e-35 42
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 7e-36 42
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 4e-35 42
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 2e-35 42
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator BAC0039 Protein 1e-35 42
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-28 41
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 2e-21 41
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-36 41
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-29 43
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-29 42
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator VFG1563 Protein 1e-35 42
Snas_1849 YP_003510638.1 winged helix family two component transcriptional regulator VFG1702 Protein 5e-36 41