Gene Information

Name : Mrub_0302 (Mrub_0302)
Accession : YP_003506100.1
Strain : Meiothermus ruber DSM 1279
Genome accession: NC_013946
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 269680 - 270345 bp
Length : 666 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; InterPro IPR001789:IPR001867; KEGG: bha:BH3157 two-component response regulator involved in phosphate regulation; COGs: COG0745 Response regul

DNA sequence :
ATGGCCCGGGTGCTGCTTGTAGACGATGACCCCGCTATTCGCGAGGTGCTGGGGGTGTATTTGCGGCAAGAAGGCTGCGA
GGTGCTGGAGGCCACCAACGGGCTCGAGGCCCTTCAGCTCCTTCCCCAAGCCGATGTGGTGATTTTGGATCTGATGCTAC
CCCAGCTTACAGGCTGGCAAGTAGCCCAGGAGTTGCGCCGGGACTACCCCGACCTGCCCTTGCTGATGCTGACGGCTCGA
GGTGAAGAAGCAGAACGCATCCAGGGGCTTGAGCTCGGCGCGGACGACTACGTCACAAAACCCTTTAGCCCCCGTGAGGT
GGTGGCTCGAGTGCGGGCCCTACTACGCCGTAGCGGCTTCAAACAGGAACTGGTGTTTGGCGATCTCATCTTACGGCCCC
GTCAACGCGAAGCCCTTTTCAAAGGGCAGGCCCTCAACCTGTCCAAGCTGGAGTTTGACCTGCTGCTGACGCTGGCCCAG
CACCCGGGGCTGGTGTGGAGTCGCGAACGCCTGCTCGAGCGGGTATGGGGGAGCGATTTTCCCGGGGTGGATCGGGTGGT
GGATGTGCATGTGGCAGGCTTGCGTAAAAAGCTAGGAGAAGATGCGGAGAACCCCCTGTATATCGAGACGGTGCGCGGCG
TGGGCTACCGCTTTCGGGGAGAATGA

Protein sequence :
MARVLLVDDDPAIREVLGVYLRQEGCEVLEATNGLEALQLLPQADVVILDLMLPQLTGWQVAQELRRDYPDLPLLMLTAR
GEEAERIQGLELGADDYVTKPFSPREVVARVRALLRRSGFKQELVFGDLILRPRQREALFKGQALNLSKLEFDLLLTLAQ
HPGLVWSRERLLERVWGSDFPGVDRVVDVHVAGLRKKLGEDAENPLYIETVRGVGYRFRGE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 5e-26 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-37 46
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-34 46
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-34 46
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-34 46
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-34 46
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-34 46
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-34 46
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-34 46
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-34 46
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-34 46
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-34 46
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-33 44
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 1e-28 44
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-31 44
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 2e-23 43
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 2e-23 43
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-33 42
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator BAC0596 Protein 6e-27 42
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 4e-28 42
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 4e-28 42
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 6e-27 42
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator BAC0039 Protein 4e-28 42
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 2e-26 41
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 7e-26 41
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 7e-26 41
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-37 41
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 9e-24 41
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator BAC0533 Protein 9e-24 41
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 2e-23 41
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-23 41
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 6e-28 41
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 6e-27 41
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 1e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator VFG1386 Protein 1e-25 45
Mrub_0302 YP_003506100.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-30 42