Gene Information

Name : Dacet_2042 (Dacet_2042)
Accession : YP_003504761.1
Strain : Denitrovibrio acetiphilus DSM 12809
Genome accession: NC_013943
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2155618 - 2156292 bp
Length : 675 bp
Strand : -
Note : KEGG: dal:Dalk_0879 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGAACAAAAGAATTCTGATTATTGAGGACGAGGAACAGATCGCCCTCCTGTTAAAAGATTATCTGTCACAGGCAGGTTT
TGAAGCTCATATGCATGGTACAGGCAAGGGAGCTCTAGAGACCGTCGAAAAGATTTCCCCTGATGCTGTGATACTTGATA
TCATGCTTCCGGAAGTGGATGGTCTCGATATATGCCGTGGTATAAGGAAAAAATCAGCTTTGCCGATAATTATGCTCACT
GCAAAGGTTGAAGAGATAGACAGGCTTATCGGGCTGGAGCTTGGTGCTGATGACTACATATGTAAACCTTTCAGCCCCAG
AGAAGTTGTTGCGAGACTGAAAGCTGTTCTGCGCCGGACAAGTCCAGAAAAACCTGTTCAGTCGATCAGCATCGGCAGCC
TTACAATTTACCCTGAACTGTATAAAGTATCTGCTGGCGGAGAGGACATTGTTCTGACCAGAAGCGAATTTATGCTTCTT
CTTACTATGGCGAAACATCCGGGAGTTGTTTATTCCCGTTCTGACCTTATTTCCAGTGTGCACGGGTACGAGTTTGAAGG
TTATGAGCGTACAGTGGACAGTCATATAAAAAACCTTCGCAAAAAGCTTTCAGAATTCGTTAATGACAACATTATCCATA
CGATATATGGGGTAGGGTATAAAATAGAAGTTTAG

Protein sequence :
MNKRILIIEDEEQIALLLKDYLSQAGFEAHMHGTGKGALETVEKISPDAVILDIMLPEVDGLDICRGIRKKSALPIIMLT
AKVEEIDRLIGLELGADDYICKPFSPREVVARLKAVLRRTSPEKPVQSISIGSLTIYPELYKVSAGGEDIVLTRSEFMLL
LTMAKHPGVVYSRSDLISSVHGYEFEGYERTVDSHIKNLRKKLSEFVNDNIIHTIYGVGYKIEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-38 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-44 48
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-44 48
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-44 48
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 9e-45 48
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-44 48
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-44 48
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-44 48
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-44 48
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-44 48
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-44 48
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 3e-48 47
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 2e-48 47
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator BAC0596 Protein 4e-48 47
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator BAC0039 Protein 3e-48 47
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 4e-48 47
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 5e-48 46
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 6e-48 46
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 5e-41 46
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 5e-37 45
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 4e-45 45
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 3e-44 45
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 4e-45 45
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-40 45
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 5e-34 43
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 9e-42 43
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-36 43
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator AF130997.1.orf0.gene Protein 7e-33 42
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 1e-40 42
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 8e-27 42
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-32 41
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-38 42
Dacet_2042 YP_003504761.1 winged helix family two component transcriptional regulator VFG1563 Protein 6e-38 41