Name : G2583_3654 (G2583_3654) Accession : YP_003501129.1 Strain : Escherichia coli CB9615 Genome accession: NC_013941 Putative virulence/resistance : Virulence Product : transcriptional regulator Function : - COG functional category : K : Transcription COG ID : COG3311 EC number : - Position : 3707743 - 3707949 bp Length : 207 bp Strand : + Note : - DNA sequence : ATGAATACCCCGGTTTCGCTGATGGATGACCAGCTGGTCGACATGGCATTTATCACTCAACTGACCGGCTTAACCGATAA GTGGTTTTATAAGCTCATCAGAGATGGTGCCTTTCCGGCCCCTATCAAAATGGGTCGCAGCTCCCGCTGGCTGAAAAGCG AAGTGGAAGCCTGGCTGCAGGCACGCATTGCACAGTCCCGTCCGTAG Protein sequence : MNTPVSLMDDQLVDMAFITQLTGLTDKWFYKLIRDGAFPAPIKMGRSSRWLKSEVEAWLQARIAQSRP |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
ECO103_3577 | YP_003223438.1 | transcriptional regulator | Not tested | LEE | Protein | 8e-27 | 100 |
unnamed | CAE85187.1 | hypothetical protein | Not tested | PAI V 536 | Protein | 5e-26 | 95 |
unnamed | CAI43835.1 | hypothetical protein | Not tested | LEE | Protein | 1e-25 | 95 |
unnamed | ADD91712.1 | putative transcriptional regulator AlpA | Not tested | PAI-I AL862 | Protein | 1e-25 | 95 |
unnamed | AAL08466.1 | unknown | Not tested | SRL | Protein | 9e-26 | 93 |
rox | AAR97599.1 | regulator of excision | Not tested | SHI-1 | Protein | 1e-25 | 92 |
S3190 | NP_838473.1 | hypothetical protein | Not tested | SHI-1 | Protein | 1e-25 | 92 |
SF2987 | NP_708761.1 | hypothetical protein | Not tested | SHI-1 | Protein | 1e-25 | 92 |
Z1627 | NP_287131.1 | hypothetical protein | Not tested | TAI | Protein | 1e-14 | 70 |
Z1188 | NP_286723.1 | hypothetical protein | Not tested | TAI | Protein | 1e-14 | 70 |
c5192 | NP_757040.1 | hypothetical protein | Not tested | PAI II CFT073 | Protein | 1e-17 | 70 |
unnamed | CAD33739.1 | hypothetical protein | Not tested | PAI I 536 | Protein | 7e-18 | 70 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
G2583_3654 | YP_003501129.1 | transcriptional regulator | VFG1057 | Protein | 4e-26 | 93 |
G2583_3654 | YP_003501129.1 | transcriptional regulator | VFG0651 | Protein | 4e-26 | 92 |
G2583_3654 | YP_003501129.1 | transcriptional regulator | VFG1480 | Protein | 3e-18 | 70 |