Gene Information

Name : insN (G2583_1586)
Accession : YP_003499152.1
Strain : Escherichia coli CB9615
Genome accession: NC_013941
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 1618019 - 1618366 bp
Length : 348 bp
Strand : -
Note : -

DNA sequence :
GTGATATCCTCACCACAACACAAAACAGGTGACTTAATGAACAAGAAAACCAAACGTACTTTCACCCCTGAATTCAGGCT
GGAATGTGCACAGCTAATTGTTGATAAGGGCTACTCATATCGACAAGCCAGTGAAGCGATGAATGTCGGTTCTACCACGC
TTGAGAGTTGGGTGCGCCAGCTCAGGCGAGAGCGTCAGGGGATTGCGCCCTCTGCCACACCTATTACTCCAGACCAGCAA
CGTATCCGCGAACTGGAAAAGCAGGTTCGCCGCCTGGAGGAACACAATACGATATTAAAAAAGGCTACCGCGCTCTTGAT
GTCCGACTCGCTGAACGGTTCACGATAG

Protein sequence :
MISSPQHKTGDLMNKKTKRTFTPEFRLECAQLIVDKGYSYRQASEAMNVGSTTLESWVRQLRRERQGIAPSATPITPDQQ
RIRELEKQVRRLEEHNTILKKATALLMSDSLNGSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 6e-43 99
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 8e-49 99
unnamed AAC31483.1 L0004 Not tested LEE Protein 5e-49 99
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 8e-49 99
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 1e-48 98
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 8e-49 98
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-32 65
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-32 65
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-32 65
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-32 65
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-32 65
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-32 65
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-32 65
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-32 65
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 4e-24 61
l7045 CAD33744.1 - Not tested PAI I 536 Protein 2e-24 60
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 2e-24 60
api80 CAF28554.1 putative transposase Not tested YAPI Protein 2e-19 55
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 2e-22 53
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 3e-20 51
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 9e-22 50
tnpA CAB61575.1 transposase A Not tested HPI Protein 8e-20 50

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
insN YP_003499152.1 hypothetical protein VFG0784 Protein 2e-49 99
insN YP_003499152.1 hypothetical protein VFG1123 Protein 7e-33 65
insN YP_003499152.1 hypothetical protein VFG1485 Protein 9e-25 60
insN YP_003499152.1 hypothetical protein VFG1553 Protein 6e-23 53