Gene Information

Name : DEFDS_0723 (DEFDS_0723)
Accession : YP_003495958.1
Strain : Deferribacter desulfuricans SSM1
Genome accession: NC_013939
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 699294 - 699968 bp
Length : 675 bp
Strand : -
Note : Similar to two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR

DNA sequence :
ATGGCAAAAATACTAATTATTGAAGATGAAAAACAGTTAAATAAACAGATAAAAGAGATATTATCTGAAGAAGGTTACAC
AGTAGATGTCTCTTTTGATGGTGCTACCGGTTTGGAAAAGATCCTTAGTTCCCCTTATGATTTAATTATACTTGATATTA
TGTTACCAGAAATAAATGGATATAATATTTTGAAACATATTAGAGAAAATAAAATATTAACTCCTGTCCTGATGATATCT
GCCAAAGGTGAAATAGATGATAGAATAAAAGGTTTGAATAGTGGAGCTGATGACTATTTATCAAAACCATTTTCAATAGC
TGAATTAATAGCAAGGGTAAAAGCAATTTTAAGAAGGACTTTTTCTCAGTATGAACAAATCATTTCAATATATAACTTAA
AAATAGATTTAAATACAAGAAAAGTTTATATAAATGATAGCGAAGTACAACTTACATCTAAAGAATATGGGATAATTGAA
TATTTAGTTTCAAACAGAAATAAAGTTGTTTCAAAGTTTGCAATAATCGAATATGTTTGGGGGGATGAGTTTGATCCTTT
CAGTATGTCTAATTTTTTAGATGTACATATTAAAAATATAAGAAAGAAAATCGGTGACAAAGAATATAAAATTATACAAA
CAGTAAGAGGTATAGGTTATCTTTTAAAAGGTTAA

Protein sequence :
MAKILIIEDEKQLNKQIKEILSEEGYTVDVSFDGATGLEKILSSPYDLIILDIMLPEINGYNILKHIRENKILTPVLMIS
AKGEIDDRIKGLNSGADDYLSKPFSIAELIARVKAILRRTFSQYEQIISIYNLKIDLNTRKVYINDSEVQLTSKEYGIIE
YLVSNRNKVVSKFAIIEYVWGDEFDPFSMSNFLDVHIKNIRKKIGDKEYKIIQTVRGIGYLLKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-36 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DEFDS_0723 YP_003495958.1 two-component response regulator AE015929.1.gene1106. Protein 1e-34 45
DEFDS_0723 YP_003495958.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-37 44
DEFDS_0723 YP_003495958.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-37 44
DEFDS_0723 YP_003495958.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-37 44
DEFDS_0723 YP_003495958.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-37 44
DEFDS_0723 YP_003495958.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-37 44
DEFDS_0723 YP_003495958.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-37 44
DEFDS_0723 YP_003495958.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-37 44
DEFDS_0723 YP_003495958.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-37 44
DEFDS_0723 YP_003495958.1 two-component response regulator BAC0111 Protein 2e-39 43
DEFDS_0723 YP_003495958.1 two-component response regulator BAC0308 Protein 4e-39 42
DEFDS_0723 YP_003495958.1 two-component response regulator NC_005054.2598277.p0 Protein 1e-30 42
DEFDS_0723 YP_003495958.1 two-component response regulator BAC0347 Protein 7e-38 42
DEFDS_0723 YP_003495958.1 two-component response regulator NC_014475.1.orf0.gen Protein 1e-30 42
DEFDS_0723 YP_003495958.1 two-component response regulator CP000675.2.gene1535. Protein 1e-36 41
DEFDS_0723 YP_003495958.1 two-component response regulator BAC0487 Protein 5e-32 41
DEFDS_0723 YP_003495958.1 two-component response regulator AM180355.1.gene1830. Protein 1e-30 41
DEFDS_0723 YP_003495958.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-35 41
DEFDS_0723 YP_003495958.1 two-component response regulator NC_009641.5332272.p0 Protein 9e-36 41
DEFDS_0723 YP_003495958.1 two-component response regulator NC_013450.8614421.p0 Protein 9e-36 41
DEFDS_0723 YP_003495958.1 two-component response regulator NC_003923.1003749.p0 Protein 1e-35 41
DEFDS_0723 YP_003495958.1 two-component response regulator NC_007793.3914279.p0 Protein 9e-36 41
DEFDS_0723 YP_003495958.1 two-component response regulator NC_002745.1124361.p0 Protein 9e-36 41
DEFDS_0723 YP_003495958.1 two-component response regulator NC_009782.5559369.p0 Protein 9e-36 41
DEFDS_0723 YP_003495958.1 two-component response regulator NC_002951.3237708.p0 Protein 9e-36 41
DEFDS_0723 YP_003495958.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-35 41
DEFDS_0723 YP_003495958.1 two-component response regulator NC_002758.1121668.p0 Protein 9e-36 41
DEFDS_0723 YP_003495958.1 two-component response regulator BAC0197 Protein 5e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
DEFDS_0723 YP_003495958.1 two-component response regulator VFG0596 Protein 4e-37 42