Gene Information

Name : terD (SCAB_81661)
Accession : YP_003493648.1
Strain : Streptomyces scabiei 87.22
Genome accession: NC_013929
Putative virulence/resistance : Resistance
Product : tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 9056583 - 9057158 bp
Length : 576 bp
Strand : -
Note : -

DNA sequence :
GTGGGAGTTTCCCTGTCCAAGGGCGGCAACGTCTCGCTCAGCAAGGCGGCACCGGGCCTCACCGCCGTCCTGGTCGGCCT
GGGCTGGGACGTGCGCACGACCACCGGCACCGACTACGACCTCGACGCGTCGGCGCTGCTGCTCGACGCCGCCGGAAAGG
TGCTCTCCGACCGGCACTTCGTCTTCTACAACAACCTCACCAGCCCGGACGGTTCGGTCGAGCACACCGGAGACAACCTC
ACCGGCGAGGGCGAGGGCGACGACGAGTCGGTCAAGGTGAACCTGGCGACCGTACCGGCCGAGGTCGACCGGATCGTCTT
CCCCGTCTCGATCCACGACGCCGAGAACCGGGGCCAGAGCTTCGGCCAGGTCCGCAACGCCTTCATCCGCGTGGTCAACC
AGGCGGGCGGCGCCGAGATCGCCCGCTACGACCTGTCCGAGGACGCCTCCACCGAGACGGCGATGGTCTTCGGCGAGCTG
TACCGCAACGGCGCCGAGTGGAAGTTCCGTGCCGTCGGGCAGGGTTACGCCTCCGGGCTGGCCGGGATCGCCGCCGACTT
CGGCGTCAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLSKAAPGLTAVLVGLGWDVRTTTGTDYDLDASALLLDAAGKVLSDRHFVFYNNLTSPDGSVEHTGDNL
TGEGEGDDESVKVNLATVPAEVDRIVFPVSIHDAENRGQSFGQVRNAFIRVVNQAGGAEIARYDLSEDASTETAMVFGEL
YRNGAEWKFRAVGQGYASGLAGIAADFGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-57 70
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 70
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-57 70
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-57 68
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 2e-52 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 2e-54 64
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-54 64
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-54 64
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-24 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-24 43
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 2e-27 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
terD YP_003493648.1 tellurium resistance protein BAC0389 Protein 4e-56 68
terD YP_003493648.1 tellurium resistance protein BAC0390 Protein 1e-57 66
terD YP_003493648.1 tellurium resistance protein BAC0392 Protein 6e-24 43